tg1030

Coordinates:982089-982604

>tg1030 hypothetical protein TGAM_1030
MVWMYEVKKSNSSYIFDLPRERIAFMFLRDGTYMMFHDEEFLCYSPKPVEVSKEELEHFEKTGEMPELVKRIKAHDFPSE
CVVKRLPPIDEDLKPFNPNRKCVVIFTGFWDTVIDYIERAGITYAVARLVDEPDKVCRFAGKGNYKVAAVRLKRNQPCLD
REEFRKVLPKGV

>tg1030 hypothetical protein TGAM_1030
gtggtttggatgtacgaggtcaaaaagagcaactccagctacatctttgacctgccccgtgagagaatagccttcatgtt
cttgagggacggaacctacatgatgttccacgacgaggagttcctctgctactcaccaaagcccgtcgaggtctcaaagg
aggaacttgagcacttcgagaaaaccggtgagatgcccgagctcgtgaaaaggatcaaggcccacgacttcccgagcgag
tgcgtcgtcaagagactgcccccaatcgacgaggatttgaagccctttaaccccaacaggaagtgtgtggtgatcttcac
cggcttctgggacacggtaatagactacattgaaagggccggaatcacatacgcggtcgcgaggctcgtggacgagcccg
acaaggtttgccggttcgctggaaagggcaactacaaggtcgcggccgtgagactgaagagaaaccagccatgtctcgac
agggaagagttcaggaaggtcctccccaaaggcgtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 981589 - 983104 (Additional range around tg1030 is :500nt.)

>Thermococcus gammatolerans EJ3 AGCTGACCCACGTCGATGAGCGGGGAGTTAAGATGGTTGAGGTTGGCCACAAGGACGTCGTTTTTCGAAAGGCCGTTGCC AAGGGCAGGATAAAGCTAAAACCGGAGACGATAGAGCTGATTAAGGCAGGGAAGACGAAGAAGGGAAACGTCATAGCGAC GGCCCAGATAGCGGGGATTCTGGCGGTGAAGAAGACGCCCGAGCTGATCCCCCTCTGCCACCCGATACCACTGACCGGCG TTGACATAACCTTCGAGTTTGGAAAGGACTACATCGAGGCCACCTGCGAGGTTCGCGCATACTACAAAACCGGAGTCGAG ATGGAAGCCTTAACCGGCGTAACCGTCGCGTTGCTCACGATATGGGACATGGTTAAAGCCGTCGAGAAGGACGAAAACGG CCAGTACCCGGTGACGAGAATCGAGGACGTCCACGTCGTTGAGAAGATTAAACAGAAATGACCAGTTAGGGTTATAAATG TCCATACCCAGTTGGGCCG gtggtttggatgtacgaggtcaaaaagagcaactccagctacatctttgacctgccccgt gagagaatagccttcatgttcttgagggacggaacctacatgatgttccacgacgaggagttcctctgctactcaccaaa gcccgtcgaggtctcaaaggaggaacttgagcacttcgagaaaaccggtgagatgcccgagctcgtgaaaaggatcaagg cccacgacttcccgagcgagtgcgtcgtcaagagactgcccccaatcgacgaggatttgaagccctttaaccccaacagg aagtgtgtggtgatcttcaccggcttctgggacacggtaatagactacattgaaagggccggaatcacatacgcggtcgc gaggctcgtggacgagcccgacaaggtttgccggttcgctggaaagggcaactacaaggtcgcggccgtgagactgaaga gaaaccagccatgtctcgacagggaagagttcaggaaggtcctccccaaaggcgtt TGATTTTTAAGCCCTCTCTCTTT TCTCCAACCATGCTCCTCCACATCGGAATAGACGACACGGACTCACCCAACGGCATGTGCACGACCTACCTCGGGGCGCT CCTCTACCGCGAGATTTCCCGCTTAGCTGAACCCACCGACCTTCCGAGGCTGATAAGGCTGAACCCGAACATCCCCTACA AGACGCGCGGGAACGGAGCGGTTGCGATGACCTTTGAGGTCGATGAGGAGGCTGTTCCGGAAGTTAAGGACCTCGTGCTG TTCTACGTCAACCAGCTGGCAGACTTCACCCACGAGAACACCAACCCAGGCGTCGTCTTTTTCGAGGGCGAAATCCCCGA AGAGCTTCAAGAGTTTTCGCTCAAAGCTTTAAGGGAGCACGTAACCATCGAAGAGGCTGAAAGAGTCGCGAGGGAAGTTG GTGCGGAGTTCTTCAAGTTCAAGCTCGGCAGGGGAATAATAGGCGCGCTCGCTTCAATTGGCTATCCCCTTGAGCGC