tg1037

Coordinates:989663-990307

>tg1037 Metallophosphoesterase, Calcineurin-like family
MLVVAVTDVHGDSKAAEELAERIVKMEREPDAIFIAGDITNFGSASVAEKVLRPLLELGIPIVAVHGNCDGRDVPEYLEE
LGISAHDRRVEVRGIGVVGIGGSNITPFHTIWELSEEEIEAILRRNYRAGDVILSHVPPYGTKVDLTRSGIHVGSKALRK
FIWENKPPLVITGHIHEARGVDKVNGSLVVNPGPLFRGYYALVEIEETRVSLMRL

>tg1037 Metallophosphoesterase, Calcineurin-like family
atgcttgtggtggccgtaacagacgtccacggggattcaaaggccgcggaagagctcgccgagaggatagtgaagatgga
aagggaaccagatgcaatatttatagccggggacatcactaactttgggagtgccagcgttgcggagaaagttctaagac
ctctgcttgagctgggaataccgatcgtggcagttcacggcaactgtgatggcagggacgttccagagtaccttgaggag
ctcgggatctcagcccacgataggcgggttgaagtcagggggattggggtggtgggcatcggcgggtcaaatataacacc
ttttcacacgatctgggagctgagcgaggaggagatcgaggcaatcctgaggaggaactatcgggctggagatgtaatcc
tgtcccacgtcccgccatatgggactaaggtggatctaacccgttccggcattcacgtggggagcaaagccttgaggaag
ttcatctgggaaaacaagccacccttagttattaccgggcacatccacgaggcgaggggggtggacaaggtgaacgggag
ccttgtggtcaaccccggacctctattcaggggctactacgcccttgtggagattgaggaaacacgcgtatctttgatgc
gcctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 989163 - 990807 (Additional range around tg1037 is :500nt.)

>Thermococcus gammatolerans EJ3 GAACTCCACGGAGCGGCCCCTCAGTATTATCAGGAACAGCCATATCAGCGTTACGATTACCAGGAGGAGTAGAATGAGCA TAGTGGGGCCCAGGTCGAAGAGCTTGATGAGGGCAAAACCGGAGTAGTACAGGTTTATTGCCCCAAAGAGCATCAAGAAC ATCAGCAGGATTATGGTGATCGCGGGGAGCCTTGAGACCTTCACCATGAACTCGTGAATGAGGTAGCGCGTTTTCCGCGT TGCCTCAAGCTCGCCGTAGATCAGGATCAGCCCAACGCCGAGTGCCACGAGAGACAGGACAAAGCCCTTGAGACCGAAGG CGATGTAGTACTTCGGCATCAGAAGAAAGTTCAGCACTCCCAGGATGTATCCGGTTATTAAGAGGGCCATCAGGGTTGAC ATCTTTCTCATTTCAATCCCTCCCTTCGAACAGACTGGAATTAAAACGTTCCAAAAATATAAAAGGGTTGTGGACTATGG AGCGAATTTGGGGGATGGGA atgcttgtggtggccgtaacagacgtccacggggattcaaaggccgcggaagagctcgc cgagaggatagtgaagatggaaagggaaccagatgcaatatttatagccggggacatcactaactttgggagtgccagcg ttgcggagaaagttctaagacctctgcttgagctgggaataccgatcgtggcagttcacggcaactgtgatggcagggac gttccagagtaccttgaggagctcgggatctcagcccacgataggcgggttgaagtcagggggattggggtggtgggcat cggcgggtcaaatataacaccttttcacacgatctgggagctgagcgaggaggagatcgaggcaatcctgaggaggaact atcgggctggagatgtaatcctgtcccacgtcccgccatatgggactaaggtggatctaacccgttccggcattcacgtg gggagcaaagccttgaggaagttcatctgggaaaacaagccacccttagttattaccgggcacatccacgaggcgagggg ggtggacaaggtgaacgggagccttgtggtcaaccccggacctctattcaggggctactacgcccttgtggagattgagg aaacacgcgtatctttgatgcgcctc TGAGCAACCCTTTTATATCTTCTGTACTAACGTTAAGACGGTGATTTTCATGG AGGATCCCTACATCTGGGCGGAGAACCTGAAGGATGAGCGCGTTCTGAAGCTCGTCGAGGAGGAGAACAAGCGCTTTAGA GAGTTCGTGGGCGAGCTGAGCGACGAGCTCTTCCCCGAGGTCTGGGAGTACTACTCAATTCCAACGCTTCACCAGGTGAA GCTAACGGAGAGGGGCATCATAGGGATGTACCGCGAGGGGGAGGGGCAGGTTATCAGATGGCTCGGCGGGGATGCCATAG TTGACTCAAAGGAGCTTGAGAAAGAACTTAACGACGAAGTTCTCCTTCAAGGCTTCACGGCAGATAGAAAGGGTAGATTC TTAGCCTACAGCTTCTCGATAGGCGGTGCAGATGAGGGGATAACAAGGATAGTAGACCTCGAAACCGGCGAACTCCTTGA GGAATTCAAACCTTCCGTGTGGAACGTCACATTTCTTGAGAACGGC