tg1048

Coordinates:1004171-1004500

>tg1048 Transcription elongation factor S (TFS_arch)
MKFCPKCGNLMLPDRKRKVWVCRSCGYEEPFDEEKDREKTRITQKVEHKPDEGIIVVEQDLKTLPTTKVTCPKCGNDTAY
WWELQTRAGDEPSTIFYKCTKCGYVWRSYE

>tg1048 Transcription elongation factor S (TFS_arch)
atgaagttctgcccgaagtgcggtaatctcatgctcccggacagaaagaggaaggtgtgggtctgccgctcatgtggcta
cgaagagcccttcgacgaagagaaagacagagaaaaaacccggataactcagaaggtggagcataagccagacgagggca
tcatcgtagttgagcaggacctgaaaacgctcccgacgactaaggtaacctgtccgaagtgcggcaatgacacggcctac
tggtgggagctccagacgagggcgggcgatgaaccgagcacgatattctacaagtgcaccaagtgcggctacgtctggag
gtcttacgag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1003671 - 1005000 (Additional range around tg1048 is :500nt.)

>Thermococcus gammatolerans EJ3 CCGCAGGGGGCGTGACTGACCCACTCGGTAGCTTCAAACACCTTGACGTCCCATTCAGGCTTTAGCCTCTTGACTCGTGA GGCCGTGCTCATTCCAGCGGCTCCACCACCGATGATGACTACCTTCTTTCCCATTTCCGAATCACCGGGGAAGGTTCAAA ACCTTAGGTTAAAAATCTGTCTCAGGTCTTTCTAAGTATAACCTCGTATGTTTTGTCGTCCTTCATAATCCCCAGTACGA GGCTTTTGTCATAGTCTATGAACTTCGCCCCGGTGAGTGAGTAACCCTCCTTTTCCAGAAACTCCCTTATTTTGAGACCG AGATCGCCAAAGAGCTCAGCCGCAAGTGTGGCCAGGCTTGGTTCTTCTATCCTAAGCTCCCGGTGGTATCTCCTCGCCAG CTCAAAAACGTCCAGTTTCTCCATAACCATCACCATAGAACGATCGTTGCAAAGGTTTTTATTTCCTTCCCATATACCAC CCCAAGCGGGGGTGAGAGA atgaagttctgcccgaagtgcggtaatctcatgctcccggacagaaagaggaaggtgtgg gtctgccgctcatgtggctacgaagagcccttcgacgaagagaaagacagagaaaaaacccggataactcagaaggtgga gcataagccagacgagggcatcatcgtagttgagcaggacctgaaaacgctcccgacgactaaggtaacctgtccgaagt gcggcaatgacacggcctactggtgggagctccagacgagggcgggcgatgaaccgagcacgatattctacaagtgcacc aagtgcggctacgtctggaggtcttacgag TGAACGAGCTCGAGCGTGAGGTCGTGAAGAGACTGGCGGAGAAGGCCCT GAAGGAGCTTGAGGAAGCCTACCGCAGGGTGCCCGACGTGGACAATGGAAAAGCTTATCTATTCCGGGGAAAAGAAAGGG TTAGGCTCATGCTCGAGATACTCAATAAGGAGGTGTAAAGATGCCGTTTGAGATCGTTTTTGACGGAGCGAAGGAGTTTG CGGACCTAATAGCAACCGCCAGCAACCTCATTGATGAGGCGGCCTTTAAGATCACCGAGGAAGGGGTCAGCATGCGCGCT ATGGACCCAAGCAGAGTCGTTCTCATAGACCTCAACCTCCCGGAGAGTATATTCTCCAAGTACGAAGTAGAGGAGCCCGA AACGATAGGGATCAACATGGACCACTTCAAGAAGATCCTCAAAAGGGGCAAGAGCAAGGACACGCTCATACTCAGGAAGG GAGACGAGAACTTCCTCGAGATAACCTTCGAAGGAACGGCCAAGAGAACCT