tg1060

Coordinates:1016394-1017032

>tg1060 Multiple antibiotic resistance (MarC)-related protein
MIELLKTFVILYGGLFAITNPVGAVPVFLSVTHDLSWRERREIATKSAVTVVVTLIIFALIGQWIFRFFGSTTDAFAIAG
GILLFRMAMEMLSGKLSSVKISRDDTEELDDETVTLEEVAVIPLAIPLISGPGAITTVMLYMANTNTMTERAVLILVILA
IGMTVWATLCSANRIKRALGRVGIKVMTRMMGLILTSMAVQMIINGIKGAFGL

>tg1060 Multiple antibiotic resistance (MarC)-related protein
atgattgagctcctcaagacgttcgtgatcctgtacggtggtctctttgcgataacgaaccccgttggagcggttccagt
gttcctcagcgtcacccatgatctctcgtggagggaaagaagggaaatagccactaagtctgccgtaaccgtcgtggtaa
cccttataatcttcgccctcataggccagtggatattccggttctttgggtcgacgaccgacgccttcgctatagcaggg
ggcatactcctcttcaggatggcaatggagatgctctcgggaaagctgtcgtcggttaagataagcagggacgacaccga
agagctggacgatgaaacggtaacccttgaagaggtggcggtgattcccctcgcaattcccctgatctccggcccgggtg
ccataactacggttatgctctacatggcgaacacgaatacaatgaccgagcgagcggtgctgatcctcgttatactcgcc
atcggcatgacggtgtgggccaccctatgttcggccaacaggataaagcgcgccctcggccgtgtgggcatcaaagttat
gacgaggatgatgggcctcatactcacgtcgatggcagttcagatgataatcaacgggatcaagggggcttttggactg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1015894 - 1017532 (Additional range around tg1060 is :500nt.)

>Thermococcus gammatolerans EJ3 TACGAAAACACCTTAAAACCCCTATCGATACCACTACGGTGATACTGGAATGAGCGGACCTGTTAAGGGAAGGGTCGAGT GGTTCAGGGATTACCAGTTCATCGGCAGAATAGAGGGCGACAAATGTTCCGTGATTCTAGGGGAAGGGGGTATAAGCCCC ATGAAGCTTCTTCTCCTGAGTGTCGCTGGCTGTACTGCCTACGACGTGGTTATGATCCTCAAGAAGATGCGCGAACCTAT CGAGGGCCTGGAGGTTGAGATCTCCGGTGAGAGAAGTGAGGAACACCCGAAGGTTTACCGCCGGGTTCACCTGCACTACC GCATTCACGGCAACGTGAGGGAGGAAAAGGCGAAGAGAGCCATAGAGCTCAGCCAGGACAAGTACTGCTCAGCCTCTGCC CATATGAAGCTCAGCGGTGCGGAGGTCACGTACTCCCTTGAGATCATCCCGGGGCGGTAGATTTTTAAGTTCCCACCTTA TCCGGGGCCGGTGAAGTTTC atgattgagctcctcaagacgttcgtgatcctgtacggtggtctctttgcgataacgaa ccccgttggagcggttccagtgttcctcagcgtcacccatgatctctcgtggagggaaagaagggaaatagccactaagt ctgccgtaaccgtcgtggtaacccttataatcttcgccctcataggccagtggatattccggttctttgggtcgacgacc gacgccttcgctatagcagggggcatactcctcttcaggatggcaatggagatgctctcgggaaagctgtcgtcggttaa gataagcagggacgacaccgaagagctggacgatgaaacggtaacccttgaagaggtggcggtgattcccctcgcaattc ccctgatctccggcccgggtgccataactacggttatgctctacatggcgaacacgaatacaatgaccgagcgagcggtg ctgatcctcgttatactcgccatcggcatgacggtgtgggccaccctatgttcggccaacaggataaagcgcgccctcgg ccgtgtgggcatcaaagttatgacgaggatgatgggcctcatactcacgtcgatggcagttcagatgataatcaacggga tcaagggggcttttggactg TGAGCTCCCCGGGTTGATAAAAAATGTCCCTCCTACTGGTTTTTGAATTTACCCTCCTC TAAGAGAGAAATCCTTAAATACCATAAATGCGGAACCTAACACGACAACATTAGCCGTGTTGGGGGATCTCAATGGGATT TACCTTTTGGAGGGTACTTGTTCCCGCTATCCTTATCCTCGTCGGTCTTCTCGCAGGAGCCTGGCTTATGAACGATGGTC CTTATGGGATCCCAGTAAACGGTAGTTCTCATGAGACCTCCGGTTCTTTCAACTGCACAGGTGAGTTTAAAGCCCCTTCG AACTCCTTCGGCTGGTTGGCCGTCGCTGAGAGGTTTGAGGACCACTGGGTGAGGTTCACAGAGGTGTTCGCCCTCATCCC AAAGGTGGACCTCAGGGCTTCCAATAGCTACGGCAGGCTTTACATCGAGAACTGGACGTCCGGAATGAACATTAAGCCCC CCTGCTACGTCCAGGGGGGAGAGGTCGTGTTTGAAACGAA