tg1065

Coordinates:1019261-1020193

>tg1065 ATP:dephospho-CoA triphosphoribosyl transferase (citG)
MIAMERWSIVKAFLLGSLLEATIPKPGNVSRHRDFEDLSIYHFLFGNTALVPIYHEAVKVGELVRKGILSPSEAGLGDLI
RRGTEAVRRVQDANPNFGVIALSIPLMAGLAMGRNVLEGREKATLLLRESTVRDTMELYRAIRTLNPKGIGKAERYDVYS
DESFRELFEDRVNLWKLGEISCERELIFCEWISGYSLTYSTADRLVELLSREPLEEAVKKAFVELLAERRDTLIERKAGR
KEAELVRKRARELLEGRISTEEFESFMAEKGDLRNPGSLADVMAVSLSLLALSGLRIEMRNGRVFGVIGRS

>tg1065 ATP:dephospho-CoA triphosphoribosyl transferase (citG)
gtgatagcgatggagagatggagtatcgtgaaggctttcctgctcgggtccctcctggaggctaccataccaaaacccgg
aaacgttagcaggcatagggattttgaggatctgagcatctaccattttctcttcgggaacaccgccctcgttcccattt
accatgaggccgtgaaggttggtgagctggtgcgaaaagggatcctctccccctcagaggccggccttggggatctgata
agaaggggaactgaagcggtaaggcgagtgcaggacgccaacccaaactttggcgttattgccctctcgatcccactgat
ggctggcctcgcaatgggaaggaacgttcttgaaggcagggaaaaagctactcttctcctccgtgagtccactgttaggg
acacgatggaactttaccgggcaatcaggacgcttaacccaaagggaatagggaaggcagagaggtacgacgtgtacagc
gacgagtcattccgggagctcttcgaggacagggtgaacctctggaagctcggggagataagctgtgagagagagctgat
cttttgcgagtggatcagcggctattccctgacatactcaaccgccgacaggctcgtggagctactctcgcgggagccac
ttgaggaggccgttaaaaaggccttcgttgagcttctcgccgagaggagggacaccctcatagagaggaaggccggaagg
aaggaggcagagctcgtgcggaaaagggccagggaactcctggaggggcggataagcaccgaggagttcgaatccttcat
ggccgagaagggcgacctgcggaaccccggcagtctggccgatgtaatggccgtctccctaagccttctggccctctcgg
ggctgagaatagagatgagaaacgggagagtttttggggttattggacgatcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1018761 - 1020693 (Additional range around tg1065 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCTTGATACCTCGAAATTTTTAAATACTCCCTGTGGTAATTGGGGTTGGATGGTGAACGGGATGACCGAGGTCAGCAAG AGGTTGAAGAGGTCAAAAACGAACAGGATGCTCCTTGGTGTCCTGGGGGGACTGGCGGAGTACCTGAACGTTGATCCGAC GATCCTTAGGTTGATCTTTGTGGTTCTGCTCGTCTTCAATCCGGTCACGATGGCACTCCTATACTTCCTGGCAGCCCTTG TGATACCCGAGGAGGAAGGGACGGAGAAGCCCCTGAGCGAGAGCATCGGGGATCTGGGGGAGGAGGTAAACCGTGTTGTG TCGAGTGATGAGGGTTTAATAAAGGCCGTGATAGCGGTCGTCGTTGTAATCGCCGCAGTGTACCTCATCACTTTCTTCCT GCCCCTCATGCTAGTCTTTCCATCGAGGACGGTCGTGACGGTATCTTTCCCCCTCGGGCTCCTCCTGGCGGCGCTTGTCC TGCTGTTGCTCATCAAGCG gtgatagcgatggagagatggagtatcgtgaaggctttcctgctcgggtccctcctggag gctaccataccaaaacccggaaacgttagcaggcatagggattttgaggatctgagcatctaccattttctcttcgggaa caccgccctcgttcccatttaccatgaggccgtgaaggttggtgagctggtgcgaaaagggatcctctccccctcagagg ccggccttggggatctgataagaaggggaactgaagcggtaaggcgagtgcaggacgccaacccaaactttggcgttatt gccctctcgatcccactgatggctggcctcgcaatgggaaggaacgttcttgaaggcagggaaaaagctactcttctcct ccgtgagtccactgttagggacacgatggaactttaccgggcaatcaggacgcttaacccaaagggaatagggaaggcag agaggtacgacgtgtacagcgacgagtcattccgggagctcttcgaggacagggtgaacctctggaagctcggggagata agctgtgagagagagctgatcttttgcgagtggatcagcggctattccctgacatactcaaccgccgacaggctcgtgga gctactctcgcgggagccacttgaggaggccgttaaaaaggccttcgttgagcttctcgccgagaggagggacaccctca tagagaggaaggccggaaggaaggaggcagagctcgtgcggaaaagggccagggaactcctggaggggcggataagcacc gaggagttcgaatccttcatggccgagaagggcgacctgcggaaccccggcagtctggccgatgtaatggccgtctccct aagccttctggccctctcggggctgagaatagagatgagaaacgggagagtttttggggttattggacgatcc TGAGCC TCTTTGCAGCGGGGGCGTAGCCGAGGGCCTTCGTGTCTATAACCACCGCATCGCCGCCGAGCTCTTCGAGGAGCCTTATC TTAAGTCCTGAAAGCTCCAGTATCTCTTCATCTCCCCCGAACTCCTCCTTCACCTGCTCCTTTATGAACTCGTAGGCCTC CAAGCCGACCAGAACGACGTCCGGCTCGTAGCCGTCGAGCTTCAGCTCGTTGGCCTTCTCCTCTATATCGCTCAGAACGC GTATCAGATCACCGCGCATTTTGGACACCGAAAAAAGTGGGGAGGGGGACTTAAAAGGGTTGCTCACCCGGCCGAGAAAA CCTCAACGTAGGGTTTTAGGGTTTCCTCCTCTCCCATTGCCATGAAAACCCTGAGCAGACCGCGACCCTTTACCTCTGCC ACCTCGACGTAGAGGTACCTGCTACCTTTCCTGTAAAGTCCAGCCATCAGCGGCTTGAAGCAGTCGTTTTCCCTCGGTGT CCTCCAGAGGGCAC