tg1074

Coordinates:1026028-1026558

>tg1074 Deoxycytidylate deaminase (dCMP deaminase)
MGVEISLDRARAERIKKIRPTKDEYFMLIAKLVSLRATCPRLRVGAVAVKDGYILATGYNGAPRGMDHCIDVGCLIVDGH
CHRAVHAEQNVIAMAARKGISLEGATLYVTHFPCDTCFKLVINAGIKEIVYEEMYPNEATEILLKEAQEKGIVKIRQFKL
PKDRVRLFLEELFGDDF

>tg1074 Deoxycytidylate deaminase (dCMP deaminase)
ttgggcgtcgagatttcccttgacagggcgagggccgagcgaataaagaagattcgcccaacgaaggatgagtacttcat
gctcatagcgaagctcgtctcgttgagggccacctgtccgaggctaagggttggggcagtcgccgttaaggacggctaca
ttttggccactggctacaacggtgcaccaagggggatggaccactgcatcgacgtgggttgccttatcgttgacggccac
tgccacagggcggttcatgccgagcagaacgtcatagcaatggcagcgaggaaggggataagccttgagggagccaccct
ttacgttacgcactttccctgcgacacctgcttcaagctggtcataaacgcggggatcaaggagatcgtctacgaggaga
tgtatcccaacgaggcgacggagatactgctgaaggaggcacaggagaagggaatagtaaagataaggcagttcaaactg
cccaaggacagggtaaggctctttctggaggaactgtttggggacgacttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1025528 - 1027058 (Additional range around tg1074 is :500nt.)

>Thermococcus gammatolerans EJ3 TGAGATACTGGACGACGAAGAGATAGCCGCGGTGGTAGCCCATGAGCTCGGACACATTAAAAACAGGGACACTATCTTCT TTCCACTCGTTGCTTACGTCAGGATATTTGCGTTCCTGATGCCCTTCCTCATCCTGGTCTTGACCCAGAGCTTCTGGATA GCGATAGGGAGCTTTGCCCTGTACCTGTGGTTCGAGCTGGAGAGGTCAAAATTCCTGAGGAGCAGGGAGTTTAAGGCGGA CGATGTTGCCCTCAGGCTTCTTGACAGACCCCTCTCCCTGAAGGAGGCACTGGAGGAGCTGAAGTACTACGAAGACCTGA GGGCCAGGGTTAAGAACCAAGCCCTGCCCGGGATAGAGCCCACCATAGACAGGCCGTCCCAGGAGAAGCGGAACTACTGG AGGCCGAGCTTCCTGATATTCCCCACCCACCCCTCCTACGAGGAGAGGATATTCAGAATAGTGGCATACTCCATCATCTC CTCGTGAGGGGGTGTAACC ttgggcgtcgagatttcccttgacagggcgagggccgagcgaataaagaagattcgccca acgaaggatgagtacttcatgctcatagcgaagctcgtctcgttgagggccacctgtccgaggctaagggttggggcagt cgccgttaaggacggctacattttggccactggctacaacggtgcaccaagggggatggaccactgcatcgacgtgggtt gccttatcgttgacggccactgccacagggcggttcatgccgagcagaacgtcatagcaatggcagcgaggaaggggata agccttgagggagccaccctttacgttacgcactttccctgcgacacctgcttcaagctggtcataaacgcggggatcaa ggagatcgtctacgaggagatgtatcccaacgaggcgacggagatactgctgaaggaggcacaggagaagggaatagtaa agataaggcagttcaaactgcccaaggacagggtaaggctctttctggaggaactgtttggggacgacttt TAGCGCTC TTCAAGCTTTTTAAGCCGTTCGTTTATTTCCTCCAGTTCTATCGCAACTTTCCTCGTGAGTTCAGTTATCTCCCTCTTAG TCCTGTCGATCTCGACGTAGAGCTGGAACATAAGCAGAAATATCAAACCTATCGAGACCACGAAGAGCGCATCAAGACCC CTGCCGAGTCCCAGCAGACCCTTTATCTCCAGGGAAATTCTGACCGGGAAGACCGCGATAACTGCGAAAATGCCGAATAT CATGAGCCACGAAACGAAGCCGTACCAGTCTATCCTTCCCCGCCTGTAGTCGTTGATTATCCTCACGAGGAGGTAAACTA TCGCCGCGAGGGCTATTATCTGAACCGCATACATCCCCATCACCTCAGTTTGTCAAACAGCAGGTTTAGTGCGATTTTTA CGCCTTCAAGAACGTTGGTTCCCTTTTTCATGGAGTACTCGGTGTAGACCGCTTTGATTGGAACCTCAACGATTCTGCAA CCATGCTTTGCG