tg1075

Coordinates:1026574-1027359

>tg1075 Heat shock protein/ Zn-dependent protease with chaperone function, M48 family
MMLFIPLALMLLLTYVASGYFGLILAGLLFTGLLILGRLSLSGKCQNCHPIARAASAELIKKLYSILERANLRDVEIYAL
EEYIPNAYSYGRRVVLSLGLFEILDDEEIAAVVAHELGHIKNRDTIFFPLVAYVRIFAFLMPFLILVLTQSFWIAIGSFA
LYLWFELERSKFLRSREFKADDVALRLLDRPLSLKEALEELKYYEDLRARVKNQALPGIEPTIDRPSQEKRNYWRPSFLI
FPTHPSYEERIFRIVAYSIISS

>tg1075 Heat shock protein/ Zn-dependent protease with chaperone function, M48 family
atgatgttgttcatccccctcgcgttgatgcttttacttacctacgtcgcctcgggttacttcgggctgatcctggcggg
tcttctcttcaccggcctcctgatcctcgggaggctctccctcagtggaaagtgtcagaactgtcaccctatagcccggg
cagcttctgcggagctcatcaaaaaactctactccatcctggagcgggctaacctccgggacgttgagatatacgccctc
gaggagtacatccccaacgcctattcctacggcagaagggtcgtcctctcgctcggtctctttgagatactggacgacga
agagatagccgcggtggtagcccatgagctcggacacattaaaaacagggacactatcttctttccactcgttgcttacg
tcaggatatttgcgttcctgatgcccttcctcatcctggtcttgacccagagcttctggatagcgatagggagctttgcc
ctgtacctgtggttcgagctggagaggtcaaaattcctgaggagcagggagtttaaggcggacgatgttgccctcaggct
tcttgacagacccctctccctgaaggaggcactggaggagctgaagtactacgaagacctgagggccagggttaagaacc
aagccctgcccgggatagagcccaccatagacaggccgtcccaggagaagcggaactactggaggccgagcttcctgata
ttccccacccacccctcctacgaggagaggatattcagaatagtggcatactccatcatctcctcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1026074 - 1027859 (Additional range around tg1075 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGAGTGGTGGCCCTCCACACCTTCTCGGTGCCGGGCCAACCGCTCATCATCGGCCGTTCTCTAAACCTCCAGAAAAGCT TTTATGGTTGTCGGTGGAGATTAGTTCTGGAGGGTTGGGAATGGAACCTCATGAGTTCAAGCTCACGGAGGAGGGTATCA AGGCCGTTCTTCCTCCCCTCGAGGCGGAGATAATGGAGTACATGTGGAAGGTCAAAGTGGCAACCGCGGGTGAAGTCTAC GAGCACATGAAGAAGAGCCATCCGGAGATGAGGCGCTCCACCGTCAGCATACTGATGAACCGCCTCTGCGAGAAGGGCCT TCTCTCAAGGAGCGTGGACTATGGAAGGGGGGGTATGAGGTACGTTTACTCAATAACGACAACCAGGGAGGAGTTCGAGG AGAGGGTTGTCCAGCGCATCCTCGACGCACTCATGAGCAACTTCAGAGAGGCCACCTACGCTTACCTCTCCCGGATCAGG AAGGAGTGAGGGGTAGGAA atgatgttgttcatccccctcgcgttgatgcttttacttacctacgtcgcctcgggttac ttcgggctgatcctggcgggtcttctcttcaccggcctcctgatcctcgggaggctctccctcagtggaaagtgtcagaa ctgtcaccctatagcccgggcagcttctgcggagctcatcaaaaaactctactccatcctggagcgggctaacctccggg acgttgagatatacgccctcgaggagtacatccccaacgcctattcctacggcagaagggtcgtcctctcgctcggtctc tttgagatactggacgacgaagagatagccgcggtggtagcccatgagctcggacacattaaaaacagggacactatctt ctttccactcgttgcttacgtcaggatatttgcgttcctgatgcccttcctcatcctggtcttgacccagagcttctgga tagcgatagggagctttgccctgtacctgtggttcgagctggagaggtcaaaattcctgaggagcagggagtttaaggcg gacgatgttgccctcaggcttcttgacagacccctctccctgaaggaggcactggaggagctgaagtactacgaagacct gagggccagggttaagaaccaagccctgcccgggatagagcccaccatagacaggccgtcccaggagaagcggaactact ggaggccgagcttcctgatattccccacccacccctcctacgaggagaggatattcagaatagtggcatactccatcatc tcctcg TGAGGGGGTGTAACCTTGGGCGTCGAGATTTCCCTTGACAGGGCGAGGGCCGAGCGAATAAAGAAGATTCGCC CAACGAAGGATGAGTACTTCATGCTCATAGCGAAGCTCGTCTCGTTGAGGGCCACCTGTCCGAGGCTAAGGGTTGGGGCA GTCGCCGTTAAGGACGGCTACATTTTGGCCACTGGCTACAACGGTGCACCAAGGGGGATGGACCACTGCATCGACGTGGG TTGCCTTATCGTTGACGGCCACTGCCACAGGGCGGTTCATGCCGAGCAGAACGTCATAGCAATGGCAGCGAGGAAGGGGA TAAGCCTTGAGGGAGCCACCCTTTACGTTACGCACTTTCCCTGCGACACCTGCTTCAAGCTGGTCATAAACGCGGGGATC AAGGAGATCGTCTACGAGGAGATGTATCCCAACGAGGCGACGGAGATACTGCTGAAGGAGGCACAGGAGAAGGGAATAGT AAAGATAAGGCAGTTCAAACTGCCCAA