tg1082

Coordinates:1031280-1032221

>tg1082 Ribonuclease Z
MLQVIFLGSGGIMPTRERNVPAIALRYKGEIILFDVGEGTIRQMNSAKLSPMRVEKIFITHFHGDHYLGLGGLIQTMNLW
NREKPLHIYGPKYTFEFVQNFLNSGFFRPGFEVHVHELGETRLKFKDYEIWSFKVEHGIPALGYVFKEKDKRGKFLPEKL
AQYGLRPGPILGKLEKDGKIEWNGQVIRLEDVTGPRRRGVKVVYTGDTEPCERVRLFAERADLLIHDATYLSDGDRGDSY
HSTVEEACETARRAKVKLLALFHRAFRYTYDEYLSGASKICQETGVNFVIPRDFDVLTYKSGEWKRENLLEEGK

>tg1082 Ribonuclease Z
atgctccaggtgatttttctcggtagcggcgggataatgccaacgcgcgagaggaacgttcccgctatagccctccgcta
taagggcgagatcatcctgtttgatgtaggcgagggcacgataaggcagatgaacagcgcgaagctcagccccatgaggg
tagagaagattttcatcacgcactttcacggtgaccactacctcgggctcggcgggcttattcaaacgatgaacctctgg
aaccgcgaaaagcccctccacatctacggcccgaagtacaccttcgagttcgtccagaacttcctcaacagcggtttctt
caggccgggctttgaggtgcacgtccacgagctcggcgaaacgaggttgaagttcaaggactacgaaatctggagcttca
aggtcgagcacgggattcctgctctgggctacgtcttcaaggagaaggacaagaggggaaagttcctgcctgagaagctc
gcacagtacggcctaaggccagggcccatcctcgggaagcttgagaaggatggcaaaatcgagtggaacggacaggtaat
ccgtctcgaggacgttacagggccgaggaggcgtggtgttaaggtagtctacaccggcgacaccgaaccctgcgaaaggg
tgaggctctttgccgagagggccgatttgctgattcacgacgcaacttacctcagcgatggagacaggggcgatagctat
cattcaacggttgaggaagcctgcgagaccgcgaggagagcgaaggttaagcttcttgccctcttccacagggcctttcg
ctacacctacgacgaatatctgagcggggcttcgaaaatctgccaagagaccggagtaaacttcgtcattccaagggact
ttgatgttttaacttacaaatcgggtgaatggaaacgcgaaaatctgctggaggaaggaaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1030780 - 1032721 (Additional range around tg1082 is :500nt.)

>Thermococcus gammatolerans EJ3 GCAAAGGCTTATAAACGATATGTCCAGCGATATGTCGAATACAGACATGCATGGTGGTCTTATGGAAGCTGAGGACTGGA GGGTTTACCACGAGAGGATGAAGGAAACGGCCCCTCTGACGATACACTACCCCCTGTGCGGCGGAGGGGAAGAGTGCATC TCCGCCTGTCCCTTCGGGGAGGAGATATGGGAGGTCGTGCCGATGAGAGTTAGTCTCTTCGGCCTCGGATACAAGGTCAG GCTGAGGCCCTACATGGCCCATCCCGAGAAGTGCAGGAAATGCTACATCTGCGTTGAAGCCTGCCCCACAGGGGCCCTCA CACCAGTGGATAGACCCGTCAGGCATCCTGCCTTCGTTTTCATCTACAATGCCCTTAAACTCCCCTTCAAGAAAAGGTAC GGAGTGAAGTTCGTGTTCCGAAGAGAGCATGTTGAGAAGTTCAAGCGAAACAACTGGCCGAAGGGTTAGCTATTTAACCA CTCCGCGAGAGCTACCAAC atgctccaggtgatttttctcggtagcggcgggataatgccaacgcgcgagaggaacgtt cccgctatagccctccgctataagggcgagatcatcctgtttgatgtaggcgagggcacgataaggcagatgaacagcgc gaagctcagccccatgagggtagagaagattttcatcacgcactttcacggtgaccactacctcgggctcggcgggctta ttcaaacgatgaacctctggaaccgcgaaaagcccctccacatctacggcccgaagtacaccttcgagttcgtccagaac ttcctcaacagcggtttcttcaggccgggctttgaggtgcacgtccacgagctcggcgaaacgaggttgaagttcaagga ctacgaaatctggagcttcaaggtcgagcacgggattcctgctctgggctacgtcttcaaggagaaggacaagaggggaa agttcctgcctgagaagctcgcacagtacggcctaaggccagggcccatcctcgggaagcttgagaaggatggcaaaatc gagtggaacggacaggtaatccgtctcgaggacgttacagggccgaggaggcgtggtgttaaggtagtctacaccggcga caccgaaccctgcgaaagggtgaggctctttgccgagagggccgatttgctgattcacgacgcaacttacctcagcgatg gagacaggggcgatagctatcattcaacggttgaggaagcctgcgagaccgcgaggagagcgaaggttaagcttcttgcc ctcttccacagggcctttcgctacacctacgacgaatatctgagcggggcttcgaaaatctgccaagagaccggagtaaa cttcgtcattccaagggactttgatgttttaacttacaaatcgggtgaatggaaacgcgaaaatctgctggaggaaggaa aa TGAGCTATCTCCGCTACGTCAGGCTCATAGGCACGATGCACGTCTCGCCGAGGAGCAGAGAGGAGGTCAGGAGAGAG ATAGAGAGGGTTAGACCGAACGCCATAGCGGTCGAACTAGACCCGCTCAGGTTTCAGGGCCTTTTAAGCGGGAAGCGGGC AGACCTGAGGGAGAGCCTTACCCTTGGAAGGGCCGGAATCGTGAGCTATCTGCTGACGAAGTTTGAGGAGAAACTGGGCG AAGAGTTTGGAATGGCACCGGGAGGCGAGATGCTGGCGGCCATAGAGAGCGCGGGGATTTTGGGAGTGCCGCTTATCCTC ATAGACGAAGACATCAGGGTGATAATGGGCAAGATCCTGCAGGCTCCCCTCAGAGAGAGGATTCTTCTGGCCCTTGAGGC CTCCCTCTTCTTCATCCCTGGGGTGGGAGAGGAGGTTGCCGGGGACTCCGACGTGCTGGCGTCTTACGAGGACATGATGC GGGAGTTCAGGCTCAGGTATCCT