tg1090

Coordinates:1040168-1040986

>tg1090 Manganese ABC-type transporter, permease component (mntC)
MIPEFMLRAILASITISVLLGLLSPLINMKGLAFLTHALFHALLFGAVLGMILGLVFNNLSLVMAVATLITVLIVLTIAE
LERLGFSSDSAVGIVASFVAGLTVLGFGVLYKLMAGRPYFPLTENVVSYLTGELFLITRENLLTLTGLGFAILLVLLLFY
RDFLYISFDMEGVESYGGRARFYLVLLYVLVGLVGSLIVQSVGLVTLQVVAVLPGAIGLMVSDNLKKVVLTSLLVTLTVQ
LSSVIIAYFTSIPPSGIATIILGIVYGILLVRK

>tg1090 Manganese ABC-type transporter, permease component (mntC)
gtgatccccgagttcatgctccgggccatactcgcaagcatcacaataagcgtcctcctgggcctgttgagtcctttgat
aaacatgaagggcctcgcgttcctcacccacgcactcttccacgccctcctcttcggtgccgtgctgggcatgatactcg
ggctggtgttcaacaacctctccctcgttatggcagtggcgaccttgataacggttctcatagtgctgacgatagcggaa
cttgaacgcctcggcttctcctccgattcagcggtgggaattgtggccagttttgtggcgggcttaacggttctcggctt
tggcgtgctctacaagctcatggccggcaggccgtacttcccgctcaccgagaacgtggtttcctatctaaccggcgagc
tctttctgataacccgggagaacctcctgactctaacgggtctcgggtttgcaatactcctcgtgctccttctgttttac
agggacttcctgtacataagcttcgacatggagggcgttgagagctacggggggagggccaggttctatctcgttctcct
ctacgtcctcgttggcctggttggttccctcatagttcagagcgtcggtctcgttacccttcaggtggtcgcggttctgc
cgggggcgataggacttatggtaagcgacaacttaaagaaggtcgttctgacgagcctgctcgtcacgctgactgttcag
ctctcctccgtgatcatagcttatttcacctccattcccccgagtggaatagcaacgataatcctcggtatagtctacgg
gatcctgctggtcaggaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1039668 - 1041486 (Additional range around tg1090 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGGGCGCGATCTACAAGAGGGGTCTGATACACCGGAAGATTCCCCCCGAGATCGAAGAACGGGCCCTAAATGTGCTCAG TTTTGTGGGTCTTGAGAACGTTGCCAACAAACTCTTCAGGAACCTCAGCGGGGGACAGAAGCAGAGGGTTCTTCTGGCAA GGGCACTCGTCAGCGATCCCAAGCTGCTCCTCCTAGACGAGCCGCTCTCGGCCCTGGATCCATCGGCGAGGGCCGAGGTA ACGTCTGTCTTGGACAGGATAAAGAAAAAGAAGAACATAGCCATGATAATAACGACCCACGATATAAACCCTCTCCTCGA GATAGGCGACAAGGTCATGCTCATCAACAGGCGGATGATCGCCTTTGGAAAACCTGACGAGGCCCTGACCGACGAGATAA TCAAGAGCGTCTACGGCCCAATGGCGAGGGCGATAAAGGTTGAAGAGCGCCTCTACTGCATAACGGGAGACTTCCACATT CACGTTAGGAGGGATAGGAA gtgatccccgagttcatgctccgggccatactcgcaagcatcacaataagcgtcctcct gggcctgttgagtcctttgataaacatgaagggcctcgcgttcctcacccacgcactcttccacgccctcctcttcggtg ccgtgctgggcatgatactcgggctggtgttcaacaacctctccctcgttatggcagtggcgaccttgataacggttctc atagtgctgacgatagcggaacttgaacgcctcggcttctcctccgattcagcggtgggaattgtggccagttttgtggc gggcttaacggttctcggctttggcgtgctctacaagctcatggccggcaggccgtacttcccgctcaccgagaacgtgg tttcctatctaaccggcgagctctttctgataacccgggagaacctcctgactctaacgggtctcgggtttgcaatactc ctcgtgctccttctgttttacagggacttcctgtacataagcttcgacatggagggcgttgagagctacggggggagggc caggttctatctcgttctcctctacgtcctcgttggcctggttggttccctcatagttcagagcgtcggtctcgttaccc ttcaggtggtcgcggttctgccgggggcgataggacttatggtaagcgacaacttaaagaaggtcgttctgacgagcctg ctcgtcacgctgactgttcagctctcctccgtgatcatagcttatttcacctccattcccccgagtggaatagcaacgat aatcctcggtatagtctacgggatcctgctggtcaggaag TGATCGGAATGGGGAGGAAGATAGCCGGGATAGACGAGG CCGGGAGGGGACCGGTCATTGGCCCGATGGTCATAGCGGCTGTGGTCGTTGATGAGGAGAAGCTGAAAAGTCTGGAGGAG CTGGGGGTAAGGGACTCAAAAAAGCTCACCCCTGGGAGGAGGGAGCGGCTCTTTGATGAAATAATTGCGCAATTGGATGA TTATGTAATCATTGAATTATGGCCAGAAGAGATAGACTCCAGGGAGGTAACGCTCAACGAGTTCGAGGTTGAGAACTTCT CGAAGGCCCTGAACTCACTGAAGGTTAAACCGGACGTTGTCTATATCGACGCGGCCGACGTCAAGGAGGGGCGCTTCGGG GAGGCCATAGGCAAGTTGCTCAAGTTTAAAGCGGAGATAGTTGCCGAGCACAGGGCGGACGATAAGTTTGTTCCGGTTTC AGCCGCCTCAATCCTCGCGAAGGTGGTGAGGGACAGGGCAATTGAAAAACTCAAGGAAGA