tg1096

Coordinates:1046062-1046262

>tg1096 hypothetical protein TGAM_1096
MMTMESVEKLILQELREIKEELKALNSKIDNFAGYFEADEGELRELMRELEDAKKNGVKLEEVLHEL

>tg1096 hypothetical protein TGAM_1096
gtgatgacgatggaaagcgttgaaaagctcatcctccaagaacttcgcgagatcaaggaggagcttaaggcactcaactc
gaagattgacaactttgcgggctatttcgaagccgatgaaggcgagcttcgggagctgatgagagaactggaggatgcca
agaaaaacggcgtgaagttagaggaggttctccatgagcta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1045562 - 1046762 (Additional range around tg1096 is :500nt.)

>Thermococcus gammatolerans EJ3 CAAGAGGATAGAGAGGGGAGAGCTCGTCGTCATCGACGAAGGCGCGCTCTACAACCACTACAACTCCGACACGACGAGGA CGATAGTCGTTGGCAGTCCCAACGAAAAGCAGAAGGACATCTATCAGGCGGTTCTTGAAGCCCAGAAGAAAGGCGTTGAG ATGGCGAGGCCTGGAATAACGGCGAAGGAGCTCGACACAATCGTTAGGGACGTAATCAAGGAGTACGGCTACGGCGACTA CTTCATCCACTCGACGGGACACGGTGTCGGTTTAGAGATACACGAGTGGCCGGGCGTTAACCAGAGCGACGAGACGGTTC TAAAGCCGGGCATGGTAATAACGGTAGAGCCCGGAATCTACATCCCCAAGTTCGGCGGGGTCAGGATAGAGGACACGATA GTCATCACCGAGAACGGTGCCAGGAGGCTTACCAAGACGGAGAGGGAGCTAATCTAATCCCCAAACTTTTTTATTCACAT CTACACACTACCATTGAGCG gtgatgacgatggaaagcgttgaaaagctcatcctccaagaacttcgcgagatcaagga ggagcttaaggcactcaactcgaagattgacaactttgcgggctatttcgaagccgatgaaggcgagcttcgggagctga tgagagaactggaggatgccaagaaaaacggcgtgaagttagaggaggttctccatgagcta TGAGGTCATTCTTTCGC GAAACGCTTTGAAATTTCTCAAGAAACTGCCTCCGGCTGACAGGAGTCGGATAAAGGATGCCCTTCTTAAACTCGGTCAG AACCCATGGTTCACTCAGTATAAAAAGCTCAGGGGCTATCCTTTCTACCGCATAAGGGTCGGGGATTATCGTGTAATCTA CAGCGTTGATGAGAACTCGAAGACCGTGTACGTTGTAAGAATCGGGAAGAGGGATGAGGTTTACAGGAACATCGGGTGAT GCTCATGCAGATACTCGAAGAGAAGCCCAAGGAGGGTATAGTGAAGGTAAAGGCCGAAACGCTGGACGATCTCTGGCACC TCTACCACGTCATAGATCCCGGTGATGTAGTTTATGCTAAAACACTGAGGAAGCAGGCCCAACGCTCTGACTCGCTTAGG GCCGAGAAGGTCGAGGTCATTCCGGTTTACCTTGGTGTTAAGGCGGAAAAGATAAACTTTCACAAGTTTGCAAATCAGGT TC