tg1104

Coordinates:1050947-1051180

>tg1104 Fe2+ transport protein A, putative (FeoA)
MMNMIVPLLSLVPGERGVVVDLRGGPNFRSRLYAMGLAPGAIVRVLESYPRGPIILEVGGTRLALGKGMASRVFVRKL

>tg1104 Fe2+ transport protein A, putative (FeoA)
gtgatgaacatgattgtgcctttactctcactggtgccaggggaacggggcgttgtcgttgatctgaggggagggcccaa
cttcaggagcaggctctacgcgatgggacttgctccaggagccatcgtcagggttcttgagagctatcccaggggaccca
tcatactagaggtgggcgggacgagactggcgctcggcaagggaatggcatcgagggtctttgtgaggaagctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1050447 - 1051680 (Additional range around tg1104 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCCTATTATGAGGGATGCTATGGTCAGGTCAATGATTTTTCCGAAGGCCGCATTAAGCCCTTCCATGTAACTCGCAGGG TGGCCTTTAAGCTCTTCATCTGCCATATGGACGAGGGCACCGCTCGCTATAATCGAGAGGATGAACGAAATAAGGGACAG CAGGGCAGCCGTTGTGGAAATACCAAATCCCACTTCTGGCTTTCCAGCGGTCAGGCTCGAAACGAGGTCCACAGCCGCAG GAATTGCTGGCGGAATGAAAAAGCCGTAGTTGTCAGTCATAATCTCAAGAGGCCTCCGAAGGGCTTCGCCAACATCGATT GTTCCCATAAGACACCACACTCCAACGTTTTGGGGTGAATAAGGCGTTCACCTTTATATACCCTCTCCTCTCGAAGTTTG AACCTTAAAGAGCCCAATTCGAACCTCTGAGTTTTGTTAGGCCCACCAAAGATTTATTAAGGACTTCGCCAACATCAAGT GGAATTAGGAAAACCTAACG gtgatgaacatgattgtgcctttactctcactggtgccaggggaacggggcgttgtcgt tgatctgaggggagggcccaacttcaggagcaggctctacgcgatgggacttgctccaggagccatcgtcagggttcttg agagctatcccaggggacccatcatactagaggtgggcgggacgagactggcgctcggcaagggaatggcatcgagggtc tttgtgaggaagctc TGAGGTGGTAGCATGGCGATGAGGGTTGTCGCCCTAGCCGGGAATCCCAACGTGGGGAAGACCA CAATATTCAACGACCTGACTGGGATGCGCCAGCACGTCGGCAACTGGCCCGGCGTCACCGTCGAGAAGAAGGAGGGCGTT TTTGAACATAAGGGAGAGCGATTTCTCGTCGTTGATTTGCCCGGAACTTATTCACTCACAGCCCACTCAGTTGACGAGCT CGTGGCGAGGAACTTCCTCCTCAACGGGAATCCCGATGTCGTCGTGGACGTCGTTGATGCCACCGCCGTTCTGAGGAACC TCTACCTCACGATGGAAATCTTCGAGATGGGGCTGAAGAACGTAATCATAGCCCTCAACAAGGTTGACCTTGCTGAGAAG AAGGGCATAAAGATAGACCCCGTTAAAATGTCAAAGGCCCTCGGCGTCCCGGTCGTCCCGCTCAACGCGAAGGAAGGGGC CGGAATCGAAGAGCTCAAGGAGAAAATCTGGGAGA