tg1108

Coordinates:1054776-1055579

>tg1108 hypothetical protein TGAM_1108
MTIHVLSEAAVAVAEKIKSRIIVFLETPPKEVESALLLNTKLTVVIVGPVFDVRNRRLLRLSIPPTLDRESVLNLVSAFL
IEQGLIKEGESFVYVSSSELGIKSVKKNLFAVNGFFSHSQSVVQRLLEIAIELSIEGREGHPIGTLFVVGDVKNVMKHSH
SMLPNPFKGHKINVLDRKSKEIIKEFAQLDGAFIVSSRGRILAAGVYLEVDPKSLNLRLPPGLGSRHIAAAGITKLTKAT
AISLSESGTIRIFKNGMMLLEYNPRMKY

>tg1108 hypothetical protein TGAM_1108
atgacaattcacgtccttagtgaggcggcagttgccgttgctgagaagataaagtcccggataatagtcttcttggagac
cccaccaaaggaagtcgaatcagcactcctcctcaacaccaaactgaccgtcgtcatcgtggggccggttttcgatgtgc
gcaacagacgtttactccgtctcagtatccccccaacccttgacagggagagcgttctcaacctcgtctcggccttcctg
atcgagcagggtctcataaaagagggggaatccttcgtctacgtctcgagttccgagctcggcatcaaatccgtcaaaaa
gaacctgttcgccgttaacggcttcttctcacactctcaatccgtagtccagaggctccttgagatagcaattgaactga
gcatcgagggaagggagggacacccaatcggtacgctcttcgttgtcggtgacgtcaagaacgtcatgaagcactcccac
agtatgctcccaaatcccttcaaagggcacaagataaacgttctcgacagaaaaagcaaggagatcatcaaggagttcgc
ccagctcgatggagctttcatagtaagctcacggggaagaattctggccgcgggagtttatctggaagttgacccaaaga
gcctcaacctcagacttccccccggtctgggaagcaggcacatagccgcggcgggtataaccaaactgaccaaggcaacg
gcgataagcctgtctgagagcgggacgataaggatcttcaagaacgggatgatgctcctcgagtacaacccgaggatgaa
atat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1054276 - 1056079 (Additional range around tg1108 is :500nt.)

>Thermococcus gammatolerans EJ3 GTATCACGTTCAGCGGCGTCTCCCGAATGAGGAGCACGAGCCTTCTTCTCTCCTTGAGGGCCACATCGGCGGCTCTGGTT ATCAAGTTGTCAGTTATGCCGTTGGCTATTGAGGCAAGAGTTTTCATGGAGCATGGAGCTATGACCATTGCGTCAAAGCG ATAGGAACCCGAGGCAGGGGGAGCAAAGAGATCGTCTTCGTTATAATCCGGCTTTAACTCGATCCCGAGTTCATGCCTTG CAACCGCCATCCCGCTCTTCGAGGCGAGGGTTATAACCTCATGACCAAGCATCCTGAGGGTCTCAATAAGCCTTACCCCA TAAACGCTGCCACTCGCTCCCGTTATCGCGACCACGATCCTCAACTTTTCCCCCATTCCTCTCCCCCCATTTATACAAGT TCACCCTTTTTAAGCTTACCTAATTCCCTGCGAGGATCTCCAGTTGGTAACAAAAATTTTAAATAATTCAACGGGAAGAT TCCCATAAGGGTCGAAAAA atgacaattcacgtccttagtgaggcggcagttgccgttgctgagaagataaagtcccgg ataatagtcttcttggagaccccaccaaaggaagtcgaatcagcactcctcctcaacaccaaactgaccgtcgtcatcgt ggggccggttttcgatgtgcgcaacagacgtttactccgtctcagtatccccccaacccttgacagggagagcgttctca acctcgtctcggccttcctgatcgagcagggtctcataaaagagggggaatccttcgtctacgtctcgagttccgagctc ggcatcaaatccgtcaaaaagaacctgttcgccgttaacggcttcttctcacactctcaatccgtagtccagaggctcct tgagatagcaattgaactgagcatcgagggaagggagggacacccaatcggtacgctcttcgttgtcggtgacgtcaaga acgtcatgaagcactcccacagtatgctcccaaatcccttcaaagggcacaagataaacgttctcgacagaaaaagcaag gagatcatcaaggagttcgcccagctcgatggagctttcatagtaagctcacggggaagaattctggccgcgggagttta tctggaagttgacccaaagagcctcaacctcagacttccccccggtctgggaagcaggcacatagccgcggcgggtataa ccaaactgaccaaggcaacggcgataagcctgtctgagagcgggacgataaggatcttcaagaacgggatgatgctcctc gagtacaacccgaggatgaaatat TGAAAAGTTCAGAAGAGCCACTGGTTCTCAATGCACTCGTCGCACGGCGGCTTCT CGCCGGCTATCGCCTTGAACTTCTTGTAGATACACTCCGGAAGGCCGAGCGGGCAGCGGTCGGGATACTGGCCGGGCCTG ACCTTCGTCGGGTCAAGCTTTATCTTGATGTAGGCCTCGTATTCCTCAACCTTCTTCCAGGGCAGTATCTTGGCGCCGTA GATCACGAGATCGTCCTTTATCTTGGCGTAGTCGCCAACGACAGCGTTCTCCTTTATGATAACGTTTCTGCCCACTACGA CACCTTCGCCGAGTATGGTGTCCTTCAGCTCGGCGCGCTCCTTGATTATATCGTTTCCTATGAGGACAGAGCGCTTGATG TAGGCCTTATCCTCTATTACAGTGTTCGGGCCGATGTAGGAGTAGGCCTTGATCTTGACGCCGTGTCCTACTTTGACGCC CTCGTCTATGTAAACCGGTCCCTGAATTTCGACGTCCTCCGGAAC