tg1110

Coordinates:1056248-1056727

>tg1110 Transcription regulator, Lrp-AsnC family
MIQLDDLDRAILRLLKKDARLTISEIAEALNRPESTVHFRIKKLIERGVIDHYTILLGPELRPKRTALVILQVETPIIED
FLERYVNHIMKTLSMLPNVLLVAKSGRDTVIALLGDENEEKLNAFIDENIRTLPTLKSVNVYPVDDVKKGEELVGFLVEV

>tg1110 Transcription regulator, Lrp-AsnC family
atgatacagctcgacgacctcgatagggctatactcaggttgctcaaaaaggacgcgaggctcacgatctcagagatagc
cgaagctcttaacaggcccgaatccacagttcatttcagaatcaaaaaactcatcgagaggggggttatagaccactaca
ccatactccttggacctgagctaaggcccaagcggacggcgttagttattctccaagttgagacccccataattgaggac
ttcctcgagcgctacgtgaaccacatcatgaagaccctttcaatgctccccaacgtcctcctcgtcgctaaaagcggtag
ggacaccgtcattgccctgctaggtgacgagaacgaggagaagctcaacgctttcatcgacgagaacataagaaccctgc
caacgcttaaatcggttaacgtctatccggtagatgatgtgaagaagggtgaagagctcgtgggcttcctcgtggaggtg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1055748 - 1057227 (Additional range around tg1110 is :500nt.)

>Thermococcus gammatolerans EJ3 GGCAGCGTTTATGGGGTAAGGCTTATTGAGACCCTCAGGATGCTTGGTCATGAGGTTATAACCCTCGCCTCGAAGAGCGG GATGGCGGTTGCAAGGCATGAACTCGGGATCGAGTTAAAGCCGGATTATAACGAAGACGATCTCTTTGCTCCCCCTGCCT CGGGTTCCTATCGCTTTGACGCAATGGTCATAGCTCCATGCTCCATGAAAACTCTTGCCTCAATAGCCAACGGCATAACT GACAACTTGATAACCAGAGCCGCCGATGTGGCCCTCAAGGAGAGAAGAAGGCTCGTGCTCCTCATTCGGGAGACGCCGCT GAACGTGATACACATCGAGAACATGTTGCGCGTTTCGAGGGCGGGGGCGATAGTTATGCCGGCATCTCCAGGTTTTTATA CAAAGCCCAAAACATTGGATGATATGGTAAACTTTATAATATGGAGAGTCCTAGATCAGATAGGTGTGAATGTAAACTAT CCAAGATGGGGTGAGGGGCC atgatacagctcgacgacctcgatagggctatactcaggttgctcaaaaaggacgcgag gctcacgatctcagagatagccgaagctcttaacaggcccgaatccacagttcatttcagaatcaaaaaactcatcgaga ggggggttatagaccactacaccatactccttggacctgagctaaggcccaagcggacggcgttagttattctccaagtt gagacccccataattgaggacttcctcgagcgctacgtgaaccacatcatgaagaccctttcaatgctccccaacgtcct cctcgtcgctaaaagcggtagggacaccgtcattgccctgctaggtgacgagaacgaggagaagctcaacgctttcatcg acgagaacataagaaccctgccaacgcttaaatcggttaacgtctatccggtagatgatgtgaagaagggtgaagagctc gtgggcttcctcgtggaggtg TAACCAGGGAATGGAAATCGAGGTTAAATTTCGCGTGAATTTTGAGGAAGCCAAGAAA AAGCTGGAAGTCCTCGGGGCCCGATTGCTCAGAACGGAAGAGCAGGAAGATCTCTATTTCTCCCTTCCACCGAACGAACT GTTGAGAATAAGGAGGATCAGAAATCTCGGGAAGACTTACCTGACCCACAAGCTCATCGTGGATCCCGGCAGAAACGAAG AGTTCGATGAAATCGAAGTCGAAGTCTCGGGTTTTGAAGAAATGAGGAAGATACTGAGGCGTCTCGGCCTCCAGGAGGAC GTGCTGATAAGGAAGCACCGTCTCGTTTACCGGCTTGGCGATGTTACCTTCGAGCTCAACCGGGTTGAGGGAATAGGAGA GTTTCTGGACATTGAGGTGATTTCCGAGAATCCCAAGGAGGCCAGGGAGAAGATATGGGAGTCCGCAAGAAAGTTGGGAC TCGATGAAAACGACGTTGAGCCCCGGCTTTATACAGAGTTA