tg1119

Coordinates:1065043-1065435

>tg1119 Aconitase X, putative, swiveling domain subunit (AcnX_swivel)
MKLRGRKVVGGKAEGELIVSKKPLSFLGGVDPETGIVTDAESDIRGQSIAGKILAFPRGKGSTVGSYVIYALKKNGKAPK
AIIVGEAETIVATGAIIAGIPMVQGIDVSKLKTGQRVRINADEGEVEVLDG

>tg1119 Aconitase X, putative, swiveling domain subunit (AcnX_swivel)
atgaagctgaggggaagaaaggtcgtcggcgggaaggcagagggagagctgatagtctcgaaaaaaccactctccttcct
cggcggggttgaccccgagaccggaatcgtcaccgacgcggagagcgacataagaggccagagcatagcgggcaaaatcc
tcgccttcccacgcgggaagggttcaacggttggctcctacgtaatctacgcccttaagaagaacgggaaggctccaaag
gcaataatcgtcggtgaagccgagacgattgtcgcaaccggggccataatagcagggattccaatggtccaaggaataga
cgtgtccaagctcaaaactggccagagggtgaggatcaacgccgatgaaggggaggtcgaagttctcgacggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1064543 - 1065935 (Additional range around tg1119 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCAATGGCGGCAACCGGTTCAATAGCGCTCTACCACGTCGAGGGCGAGACCCCCGAATACAGAACCGCAGTTGTTGACA AGGTGGAAGAGATTGCCGTTGAAGATGCCGACCTCAGGGCAGTGAGGGAGGAATTCTCAGACGACTGGAGCGAGATTGAC ATGATACTCATCGGCTGTCCTCACGCTTCCTTGAGAGAGATTAAAGAGGTCGCTGAGCTCCTCACCATGCGCGGAAAGCC GCTAAAAATACCGCTCTTCATCACTGCGAGCAGGGCTGTAAAGGCTTTAGCCGACTCACTCGGTTACACGGAGATCATAG AGCGCTATAACGGGCGGATTATAGCGGATTCCTGCTTCGTCGTGTCGCCGATTAAGGGCTGGTACAACGGCATCGCCACC AACAGCGGAAAGAGTGCCTTCTACTTCCGCTCCTTTGGCTTTAAGGTCAGGCTCGACGATGCAGAGAGGCTCATAAAAGA AGCCCCGTGAGGTGGTAGG atgaagctgaggggaagaaaggtcgtcggcgggaaggcagagggagagctgatagtctcg aaaaaaccactctccttcctcggcggggttgaccccgagaccggaatcgtcaccgacgcggagagcgacataagaggcca gagcatagcgggcaaaatcctcgccttcccacgcgggaagggttcaacggttggctcctacgtaatctacgcccttaaga agaacgggaaggctccaaaggcaataatcgtcggtgaagccgagacgattgtcgcaaccggggccataatagcagggatt ccaatggtccaaggaatagacgtgtccaagctcaaaactggccagagggtgaggatcaacgccgatgaaggggaggtcga agttctcgacggg TAGATTTTTAACCCTTCGTTCCCTCTTTTATCGGGGGAGAGCATGCCAAAGGGAATTTACGAGTGT GTTAACTGCGGTCACAGAGAGATAATCGAGTCAAACGAGCCCATCCTCGAGGGAGCGTGCCCCCAATGCGGCGGAGACAT GGTTCTGGTGGGGTTCAGCATTGAAGCCGAAGAACCGGGAGTTGAGATCCAAGTTCTCCCCGGGGTTGAGGAGCTTGTAT CGAGGTTCTACCGGGCGGAGTTCGTTGAAAAGCGTGGAGAGGTATACATCTTCAGGGTTAGTGAGATACTCGAGCGGGAC TTTGAGGCCGTTCTCAGGGAGTTTGAAGCTAACGGTTACTGGGCAGCACTGAAGAGGGCAGGGGGAGAGATCGTTCTGTA CGTCTTTCCGGCCGGCGAGATCAAACAGGACAATCCTAAGATAGGGATAGCGCTCTTCATTCTCACTCTTATCTCCACGC TCTGGGCGGGTTACGGCCTTGCCATTAATTACAT