tg1123

Coordinates:1068820-1069182

>tg1123 hypothetical protein TGAM_1123
MNGRKVAGFALYFLGIALGIARPPVERLACMKLPSGEVSKGINTPLLLIEVSLIMVGALFVGLGHRFKNRHELNGWLGVA
TGLGIAFVGGYARITELFAFGVVLTTLGLFVYKIGGREDAR

>tg1123 hypothetical protein TGAM_1123
gtgaacggtaggaaggttgcgggcttcgcactgtatttcctcggcatagccctagggatagccagaccgcccgttgaaag
gctcgcatgcatgaagctcccgagcggagaggtctctaaggggataaacacgccactgcttctcatcgaggtcagcctca
taatggtgggtgcactcttcgtggggctggggcaccgattcaaaaacagacatgaacttaacggctggctcggagtggct
actggtctcggcatagcttttgtggggggatacgcaagaataacggagcttttcgcgtttggcgttgttctcaccaccct
tggacttttcgtttacaaaatcggggggcgtgaggatgctcgt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1068320 - 1069682 (Additional range around tg1123 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCCCTTGCCTTTGCCGTCTTTGTTTCCGGCGCGGTTCTCCTCTGGCTGTATTATAGGCACCTGGAGAAGAAAGGACACG TCCTCGAGGACGAGAGAACGTTGAGGATAGAGGAAATCGCCTCCAGAAGAACCCTTCAGGTAGCGATGATAGTCCTGGCC TTCACGACGATTTACCTCTCGATAGCCCAAGTGGAAAAGCCCGAGCTCAGGCCCGCCTTTAAGCTAACCTCCGGCCTCTT GGCGATTCTGCTACTCCTCCACTGGGGACTCATCAACTATTATTCCCGGAGGATGTAGAGATGAAGAACCGCCTGCGCGA GCTCAGGGAGGCGAAAGGGCTCACACAGGAGGAGCTCGCAAAAGCCTTGGGAGTTACGAGGCAGACGATTATTGCGATTG AAAAAGGGAAGTACGACCCCTCCCTAAGGCTGGCTTTCAAGATTGCCCGGTTCTTCGGCCTTAAAATTGAAGACGTGTTC ATCTACGAGGGTGATTGAG gtgaacggtaggaaggttgcgggcttcgcactgtatttcctcggcatagccctagggata gccagaccgcccgttgaaaggctcgcatgcatgaagctcccgagcggagaggtctctaaggggataaacacgccactgct tctcatcgaggtcagcctcataatggtgggtgcactcttcgtggggctggggcaccgattcaaaaacagacatgaactta acggctggctcggagtggctactggtctcggcatagcttttgtggggggatacgcaagaataacggagcttttcgcgttt ggcgttgttctcaccacccttggacttttcgtttacaaaatcggggggcgtgaggatgctcgt TGAGGTTGAGAACCTT GAGAAGGATTATGGCAAGGTCAAAGCGCTGAAGGGGATAAGCTTCTCCGTCAGGGAAGGAGAGGTATTCGGTCTCATCGG GCCGAACGGGGCTGGAAAGAGCACGACCCTCAAAATCCTCGCCACCCTGCTGAGGCCAACCAAAGGAACGGCGAGGATAG CAGGCCATGATGTTGTTACGGAAGCTGACAAAGTTAGGGCCCTGATCAGCTACCTTCCCGAGGAGGCGGGAGCCTACAAA AACCTAACCGGAAGGGAGTACCTGGAGTTCATGGCGAGGCTTTACGCCAAAGACGAGCAAAAGGCCAGAAAGATGCTCCA GCTCGGCGTTGAGCTCGCCGGCCTTGGGGAGAGGCTCGACGACAAGGTCTCAACGTATTCCAAGGGAATGACGCGCAAGC TTCTCATTGCGAGGGCCCTCATGGTGAAGCCAAGGCTTGCCATTCTTGACGAGCCGGCAAGCGGACTCGACATAGTGAAC GCCT