tg1137

Coordinates:1078033-1078827

>tg1137 Membrane-bound phosphoesterase, PAP2 superfamily
MKRQSVRDIVESLNDHDVLIRLNTFLLLYFGWIGFTVLYDHLKSHSRDVTYLLLKLPFTSYHFVVSTLDLTREVFPLYLL
MKGIYYIGFSGSIALTVLFVLLYKRDLQKADELALGYLITYSICGTVYTFAHVYAPHYVYHLPGFYPDRTYLTQQEFVLP
SLHNTVAAFNIIILWKYRRELKAKLIIALNSLVPFATLLLGHHWIYDALSGIALAMVVGKMVEGRKIHVPSAFRNVNVSI
IKHATMLGFLAGGFLLILAMTMPKP

>tg1137 Membrane-bound phosphoesterase, PAP2 superfamily
atgaaacgacaatcagtcagggatattgtggagtccctcaacgaccacgacgtgcttatacggctcaacacttttctcct
gctgtacttcgggtggatagggtttacagttctctacgatcacctcaaatcccacagcagggacgttacgtatctcctcc
ttaaactccccttcacttcatatcacttcgtcgtctccacccttgacctcacgagagaagtcttcccgctttacctcctc
atgaagggtatctactacatcggattctcgggctcgatagcgttaactgtcctcttcgttctcctgtacaagagggatct
ccagaaggccgatgagctggcactggggtacctcattacatactccatctgcggtacagtctacacctttgcccacgttt
atgcgccccactacgtctaccatttacccgggttctacccggacaggacttacctgacccagcaggaatttgttctgcct
tcccttcacaacaccgtggcggcctttaacataatcatcctgtggaaataccggcgggagctcaaggccaagctcatcat
agccctcaactcactcgttcctttcgccaccctccttctcggtcaccactggatctacgacgccctctcaggcatagcac
tggcgatggtagttggtaagatggtcgagggaagaaaaatccatgttccatcagctttcaggaacgttaacgtctccata
atcaaacatgccacgatgctcggcttcctcgccggaggctttctcctgatacttgccatgacgatgcccaagccg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1077533 - 1079327 (Additional range around tg1137 is :500nt.)

>Thermococcus gammatolerans EJ3 TCGCTCGCAAGGAGCGCATCAACTGCTGCACCTTCCTTCCCGATTACACAGAAAGCCAACTCCGCCTTTTCAAGCATGGC AACGTCGTTGTTCCCGTTACCGATGGCAACGTAGGGCCTGTACCCTTCCGCGATCTCGGCCTTCTCTGCCCCGCTTGAAA CCCTTTCAATTCGGACAGGAAGCCCTTTGAACTCCTCTTCCAGAGTCCCGAAGGTATCAGCGCTCAGAATGACAACGGTG CACCGGCTGGCCAGCCTTGTGAGGAGCCCCTTGACGTCCTCCGGAACCCTTCCCTCAACCCCCAGAGTGCCGTTCAGGTC GAAGAGGATGGCATTGAATTCGATTCGTCCGTGACCAGGAACGTCAACCTCCATTTAACTCACCGGTGGAAGTTGAACGC TGGCAAGAAAAACCTTTGGTTTTATTTCAACTCCAGTGGCGGAAAAAGTGAAAAGTTTAAATAGGGTATCCCATTACTCA TAGCCGGTGGGGGAGTCCG atgaaacgacaatcagtcagggatattgtggagtccctcaacgaccacgacgtgcttata cggctcaacacttttctcctgctgtacttcgggtggatagggtttacagttctctacgatcacctcaaatcccacagcag ggacgttacgtatctcctccttaaactccccttcacttcatatcacttcgtcgtctccacccttgacctcacgagagaag tcttcccgctttacctcctcatgaagggtatctactacatcggattctcgggctcgatagcgttaactgtcctcttcgtt ctcctgtacaagagggatctccagaaggccgatgagctggcactggggtacctcattacatactccatctgcggtacagt ctacacctttgcccacgtttatgcgccccactacgtctaccatttacccgggttctacccggacaggacttacctgaccc agcaggaatttgttctgccttcccttcacaacaccgtggcggcctttaacataatcatcctgtggaaataccggcgggag ctcaaggccaagctcatcatagccctcaactcactcgttcctttcgccaccctccttctcggtcaccactggatctacga cgccctctcaggcatagcactggcgatggtagttggtaagatggtcgagggaagaaaaatccatgttccatcagctttca ggaacgttaacgtctccataatcaaacatgccacgatgctcggcttcctcgccggaggctttctcctgatacttgccatg acgatgcccaagccg TAGCGGAAAACTTATAAACCTCTCCTACTTTTTCTCCTCCGGTGCCGGGGTAGCCTAGCTCGGC AGGGCGGGGGACTCGTAATCCCCAGGTCCCGGGTTCAAATCCCGGTCCCGGCTCCACCACGTTTTTATACCCCTTTTGCG AAGAACTTTGGGTGGTTCCGTGCACCCCCTCGAGAGCGTGCTCAGGGTTAAGGGAAGCGGAAAGTTTTCAAAGAGCGAGC TCGTGGGACTGCTTACCTTCAAGCTCAGGATCATGAGCGTTGGTGAGGCCAAAGAAGCTATCTCAAAGTGGGTCGAAGAA GGCCTGCTCGTCGAGGAAGGGAATTTGCTGAGAATAAATCTCGAGGCGTTAACACAAAAAGAAGGGGAGGAGGATCTCTT CAGGGAGATGCTGTCCTTTGTGGCCTCCCAGCTGGACCTCGATGAATCAGAGGTTTTGGAAGAGCTTGAGAAGTTCTCGG GAAGGTACGGCAACCTCGACAGGAGGCTGGTTCTCT