tg1153

Coordinates:1096685-1097431

>tg1153 Metallo-beta-lactamase superfamily protein
MLVYFIGTGGSEGIPAHLCTCSTCTEARKFGFAQRRPSTLAVITDNRKAVLFDVGTDIRDFLNVPLEAIFLTHWHHDHIY
GLYKLRWMARGTVLYAPKGSADALILQDPKNLRPRILKPFDTLEVDTLKITTLKLNHGVETLGYLIEEDGKSVALLYDTK
GLPEETQEFLEERAPLRLAIVDATYPPGFDDPYHNNVDEAAELGLRLAERTVLSHISHKNLPFLELTDYVRKRWGTRVLV
AYDGMVFYV

>tg1153 Metallo-beta-lactamase superfamily protein
atgctcgtttacttcatcggcaccggcgggagcgaggggattccggcccacctctgcacctgctcgacctgcaccgaggc
gagaaagtttggcttcgcccagagaaggccctcaacgctcgcggtaatcacagacaaccgaaaagccgttctcttcgacg
ttggaaccgacatcagggactttctcaacgtcccgctcgaagcgattttcttgacgcactggcaccacgaccacatctac
ggactctacaagctccgctggatggcgaggggaacggttctctacgcgcctaaggggagcgccgacgcgctaatcctgca
ggacccgaagaacctccgcccgagaattttaaagcccttcgacactctcgaggttgatacattaaagataaccacgctaa
agctgaatcatggcgttgaaacgctcggctacctcatcgaagaggatgggaagagcgtggccctgctctacgacaccaaa
ggccttccggaggagacgcaggagtttctggaagagagggccccgctcaggctagcgattgtagatgcgacctatcctcc
gggctttgacgacccctaccacaacaacgttgacgaagcggccgaacttggacttagattggcggagagaaccgttctca
gccacatctcccacaagaacctgccgttccttgagctgaccgactacgtgagaaagagatggggcacccgggttctggtt
gcatatgacggtatggtgttttacgta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1096185 - 1097931 (Additional range around tg1153 is :500nt.)

>Thermococcus gammatolerans EJ3 ATTTACTGTGAGGAAGACGCCAGAGATTTGATGGAGTTCGTCCTGAAGGTCATGGACTTCGTGGAGGGTCTCGTTGATGC GTTCGAAAGAAGAAGTGAGGAGTAGGCTAATCAGGCGGGGGAGAGAGCGCTACCTCATGATTAAGAACTACCGGAAGTAT CTCCCAGCAATAAAGCGGGCGTGTGAGAAGGTGTTTGGTGAGTGCGAGCTCTACGTCTTCGGAAGCGTTCTCACCGGAAA GTTCACCGCAGGAAGCGACGTGGATTTGCTCATTAAGGTGAGGGAAGCCCCTCAGAGTCTGCGTGAGAGGGTAAAACTTG AGGTCAGAATCGAGGAACTCGCCGGCCTGCCGGAATATCATCCATTCGAGTTCCACATCGTTGATGAGAAGGGTTTCAGG CGATACGTCAATGTTCTAAAAGTTAAACCGGTTAAGGTCGAGCAACTTTTATAAGCGCGCATCCTATTTCACAACCATAA AATAATGGAGCTGGTCATC atgctcgtttacttcatcggcaccggcgggagcgaggggattccggcccacctctgcacc tgctcgacctgcaccgaggcgagaaagtttggcttcgcccagagaaggccctcaacgctcgcggtaatcacagacaaccg aaaagccgttctcttcgacgttggaaccgacatcagggactttctcaacgtcccgctcgaagcgattttcttgacgcact ggcaccacgaccacatctacggactctacaagctccgctggatggcgaggggaacggttctctacgcgcctaaggggagc gccgacgcgctaatcctgcaggacccgaagaacctccgcccgagaattttaaagcccttcgacactctcgaggttgatac attaaagataaccacgctaaagctgaatcatggcgttgaaacgctcggctacctcatcgaagaggatgggaagagcgtgg ccctgctctacgacaccaaaggccttccggaggagacgcaggagtttctggaagagagggccccgctcaggctagcgatt gtagatgcgacctatcctccgggctttgacgacccctaccacaacaacgttgacgaagcggccgaacttggacttagatt ggcggagagaaccgttctcagccacatctcccacaagaacctgccgttccttgagctgaccgactacgtgagaaagagat ggggcacccgggttctggttgcatatgacggtatggtgttttacgta TAAGCAAAGATAAAAGAGCGAAAGGGTTTCAA ACCTTTATCCCACCCATGACGAGGGCCATAACAGCTTTCTGGGCGTGCAAACGATTCTCGGCCTGGTCGAAGACGACGCT GTTCGGGCTGTCTATGACGTCGTCGGTGACCTCCTCTCCCCTGTGGGCCGGGAGGCAGTGCATGAAGATGTAGTCCGGCT TGGCGTGCTTCACGAGCTCCTTGTTGACCTGGAAGGGCTTAAATATCTTTCTCCTCTCCTCGGCCTCGGTTTCCTGCCCC ATGCTCGCCCAGACGTCGGTGTAGATGACATCAGCATCTTTAACGGCCTTGACGGGGTCGTGGAGGAGCTCAAAGCTTCC GCCGCTCTCGGCCGCGTTCTGCTCCGCCCACTTGATGACCCTCTCGTCCGGCTCGTAGCCCTCCGGAGTTGCAACGACGA CGTTCGCTCCAAGCTTGGTTCCGGCTATCATGAGGGAATGAGCCACGTTGTTTCCGTCCCCGACGTAG