tg1154

Coordinates:1097480-1097854

>tg1154 Nucleotidyltransferase of the DNA polymerase beta family
MRSKEEVRSRLIRRGRERYLMIKNYRKYLPAIKRACEKVFGECELYVFGSVLTGKFTAGSDVDLLIKVREAPQSLRERVK
LEVRIEELAGLPEYHPFEFHIVDEKGFRRYVNVLKVKPVKVEQLL

>tg1154 Nucleotidyltransferase of the DNA polymerase beta family
atgcgttcgaaagaagaagtgaggagtaggctaatcaggcgggggagagagcgctacctcatgattaagaactaccggaa
gtatctcccagcaataaagcgggcgtgtgagaaggtgtttggtgagtgcgagctctacgtcttcggaagcgttctcaccg
gaaagttcaccgcaggaagcgacgtggatttgctcattaaggtgagggaagcccctcagagtctgcgtgagagggtaaaa
cttgaggtcagaatcgaggaactcgccggcctgccggaatatcatccattcgagttccacatcgttgatgagaagggttt
caggcgatacgtcaatgttctaaaagttaaaccggttaaggtcgagcaactttta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1096980 - 1098354 (Additional range around tg1154 is :500nt.)

>Thermococcus gammatolerans EJ3 GTGGCCGTAGAGGCGCAACCAGCGCGCTAATCTGCCAAGCATCATGTCGGCGATGAACTTCATCATCGAAAGGTATTAAT GGGAAGCAGTTAAAGTGCTTCCGGTGGTGAGATGCACTACGAGGAGGTTGAGACACTTTTGAGGCGCTCCGGGGATTATC TTGAGCTGGCAAACGAGGCGTTTGAGCGTGAAAAGTATGATACTGCAGTGTTTTTGGCGGAACAGGCTCTCCAACTCTAC CTAAAGGCACTCATCGTGAAATACTCCGGTGTGCGGCTCAGGACGCACTCAATAAGGGAACTGCTCAAAGGGGTGGGCGA GGCACTGGGCGCGGAGGACGAGGTGGTCGAGTTCGTGAGACAGAACAGGGGACTCCTCAGGGAACTGGAGGAGGCTTATA CGGGCGCCCGCTACGAGCCGAGAATTTACTGTGAGGAAGACGCCAGAGATTTGATGGAGTTCGTCCTGAAGGTCATGGAC TTCGTGGAGGGTCTCGTTG atgcgttcgaaagaagaagtgaggagtaggctaatcaggcgggggagagagcgctacctc atgattaagaactaccggaagtatctcccagcaataaagcgggcgtgtgagaaggtgtttggtgagtgcgagctctacgt cttcggaagcgttctcaccggaaagttcaccgcaggaagcgacgtggatttgctcattaaggtgagggaagcccctcaga gtctgcgtgagagggtaaaacttgaggtcagaatcgaggaactcgccggcctgccggaatatcatccattcgagttccac atcgttgatgagaagggtttcaggcgatacgtcaatgttctaaaagttaaaccggttaaggtcgagcaactttta TAAG CGCGCATCCTATTTCACAACCATAAAATAATGGAGCTGGTCATCATGCTCGTTTACTTCATCGGCACCGGCGGGAGCGAG GGGATTCCGGCCCACCTCTGCACCTGCTCGACCTGCACCGAGGCGAGAAAGTTTGGCTTCGCCCAGAGAAGGCCCTCAAC GCTCGCGGTAATCACAGACAACCGAAAAGCCGTTCTCTTCGACGTTGGAACCGACATCAGGGACTTTCTCAACGTCCCGC TCGAAGCGATTTTCTTGACGCACTGGCACCACGACCACATCTACGGACTCTACAAGCTCCGCTGGATGGCGAGGGGAACG GTTCTCTACGCGCCTAAGGGGAGCGCCGACGCGCTAATCCTGCAGGACCCGAAGAACCTCCGCCCGAGAATTTTAAAGCC CTTCGACACTCTCGAGGTTGATACATTAAAGATAACCACGCTAAAGCTGAATCATGGCGTTGAAACGCTCGGCTACCTCA TCGAAGAGGATGGGAA