tg1164

Coordinates:1105672-1106205

>tg1164 hypothetical protein TGAM_1164
MIVVLRLGHRPERDKRITTHVALTARAFGADKIIISADEDEHVRESVEDVVRRWGGPFEIEFNPSWKKILREWRERGVIV
HLTMYGVHIDDAMPKLKEELKAGKDFLIVVGAEKVPRDVYELAHYNVAIGNQPHSEVAALAVFLDRLLDGEGLRKEFEGA
KLKIIPQERGKRVIQLDG

>tg1164 hypothetical protein TGAM_1164
atgatagtcgttttaagactcggtcacaggcctgagagagacaagaggatcacaacccacgtcgccctaacggcgagggc
cttcggggctgataaaattattatctcggcggacgaggacgagcacgtcagggagagcgtcgaggacgttgtgaggagat
ggggagggccgtttgagatagagtttaaccccagctggaagaaaatcctgagggagtggcgcgagaggggcgttatagtc
cacctgacgatgtacggggtgcacatagacgacgcaatgccgaagcttaaggaggagctgaaggccggaaaggacttcct
catcgtcgtcggtgccgagaaggttccgagagacgtttacgaactggcccactacaacgtggcaattggcaaccagcccc
acagtgaggttgccgctctggcggttttcctcgacaggctcctcgacggcgagggcctcaggaaggagttcgagggggca
aagctcaaaatcattccgcaggaaagggggaagagggtaatccagctcgacggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1105172 - 1106705 (Additional range around tg1164 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAACTCCTCTGGAGAAACTCCCTTCTCTATGAGCGCGCCGGCCGGTCCGAAAACATCTCTCCCGTGAAAGGTCGAGCTT ATCCTCCACCCGGTAAAGCGCTTAATCCTCCCAAAGTCTATCCCCCAGGCGCGTCTCGGGTTTATGTGCTTGAGCGGGAG GGTAGCCAATCCGTTGTCGGGAACGACCAGCCACTGGTCGCCCTCGATTACAACCGCCTTCCTCTCGGTCCCGACGCCCG GATCAATGACTCCAACGTGAACCGTTCCGGGAGGCGAGTACTTAACCACCTGCTCCATGACGAAGGAGCCCTCGAGTATC GAGTGCCTCGTCACCGCGTGGGTAACATCAACGAGCTTTGCGTCGGGATTAACCCGGAGCATCGCGACCTTCATCTCGCC GACGTATGGGGAGCTGAGCCCGAAGTCCGTTGTTAGAGTTATCATCCACATCACCGGAAAGGATTTATTGGCAACCCTTT AAGAGGTTGCGGGGGTTGAG atgatagtcgttttaagactcggtcacaggcctgagagagacaagaggatcacaaccca cgtcgccctaacggcgagggccttcggggctgataaaattattatctcggcggacgaggacgagcacgtcagggagagcg tcgaggacgttgtgaggagatggggagggccgtttgagatagagtttaaccccagctggaagaaaatcctgagggagtgg cgcgagaggggcgttatagtccacctgacgatgtacggggtgcacatagacgacgcaatgccgaagcttaaggaggagct gaaggccggaaaggacttcctcatcgtcgtcggtgccgagaaggttccgagagacgtttacgaactggcccactacaacg tggcaattggcaaccagccccacagtgaggttgccgctctggcggttttcctcgacaggctcctcgacggcgagggcctc aggaaggagttcgagggggcaaagctcaaaatcattccgcaggaaagggggaagagggtaatccagctcgacggg TGAA GGAAATGGTCCTCAACAGGTATCGGGAGAACGTCAGGGGCTACCTTGAGGCGATAGTTAAACCCCTCGCAAAGGCCGGGC TAACGCCGAACGCGGTTACTGTGATAGGCCTCCTACTAAGCCTGCTCTCGGCTTACCTCTACTACCTCCGCGAGCCGAGG TTAGCGGCTTTAACGCTCCTCATAGGCTCGCTCGTTGACGCCCTCGACGGAACGCTGGCGAGGCTGACCGGGAAGACGAG CCGCTTCGGGGCATTTCTCGACTCGACCTTCGACAGGATAAGCGACGGCACGGTGCTCTTTGGAATCGCGCTCGGAAGCC TCGCCGACTGGCGCGCTGCCTTCCTGACGTTCATGGGAAGCTACCTCGTCAGCTACGAGCGCTGCAGGGCCGAGTTAGCT GGCTCCGGAAAGCTCGCCGTTGGCATAGCCGAGAGGGCGGAGAGGCTGATAATCCTCATGCTATTTTCGTTCCTCGGGGC AGAATACGTTAGATA