tg1169

Coordinates:1110665-1111159

>tg1169 hypothetical protein TGAM_1169
MLLTRHAEERLVKRLTKRRNIKRVYLELWAFLDRSRRIDVNERVVIFTDGRKSLVCAKLDCERLSLDEIRERVEGLEGTY
RCVFPDRRLARETVPVKFLSEIPDGVYCFYLNREKRSLYIGSEEPLLAITLRPAKREERALSENFIASLESAAGNEDDDK
NQEPH

>tg1169 hypothetical protein TGAM_1169
atgctcctgacgaggcacgccgaggaaaggctcgtgaagagactaaccaagcggagaaacattaagcgagtttatttaga
actctgggcgttcctcgaccgctcacggaggattgatgtcaacgagcgcgtcgtaatctttaccgacgggagaaagagcc
tcgtctgcgccaaactcgactgtgagaggctttcactggatgaaattagggagcgcgttgagggtctggaggggacttac
cggtgcgtctttccggacaggaggctcgcgagggaaaccgttccagttaaatttctctctgaaattccagacggtgttta
ctgcttctaccttaacagggaaaagcggagcctttacatcggtagcgaggagcccctactcgcgataacgctgaggcctg
cgaagagggaggaaagggctctttcagaaaactttatcgccagtcttgagagtgcagctggtaatgaggacgatgataaa
aaccaagagcctcat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1110165 - 1111659 (Additional range around tg1169 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCCGAGCCAGTATTGGCAATTCAGATTGTCACCCTGAGGCCAGTTTCAACAGCGGCTCGACTGTCGTGAGAAAGACGCT TGACTTTGAGATGCCAGCAAGGAGGAGAACGTTGTTCACCGCGGGAATCGCCTTGAGAACTACCATTCCAACAGCCACGA GCTTGAAGGCCGGGTTGAGCTTTTCCAGCTTGATTGAAACGGCTATAACCCCCGCGCCGAGTGCCGTGAAGAAGGCGTAG CTGCCGAAGAAGAGCGTGGGGCTCCCGAGCCTTTCAGCTATTACTCCGTTGGCTTCGACAAAGCCCATTCTAACCCCAAA CCACGTTGTGAGCGCATCAACGAGTGCGAGCAGTATGAAGAGGAGCAGGTAGGTTCGTGCCTTCATCGCTCGGTTTTTCC TTTGAATCCTTAAATACTTTTTTTGTTAGTCAGAACATACATATGTAGGTACATGTGCATGTGCACAATGGTTTTTTCAA TGGGGCGTGGAGGGTGGAAC atgctcctgacgaggcacgccgaggaaaggctcgtgaagagactaaccaagcggagaaa cattaagcgagtttatttagaactctgggcgttcctcgaccgctcacggaggattgatgtcaacgagcgcgtcgtaatct ttaccgacgggagaaagagcctcgtctgcgccaaactcgactgtgagaggctttcactggatgaaattagggagcgcgtt gagggtctggaggggacttaccggtgcgtctttccggacaggaggctcgcgagggaaaccgttccagttaaatttctctc tgaaattccagacggtgtttactgcttctaccttaacagggaaaagcggagcctttacatcggtagcgaggagcccctac tcgcgataacgctgaggcctgcgaagagggaggaaagggctctttcagaaaactttatcgccagtcttgagagtgcagct ggtaatgaggacgatgataaaaaccaagagcctcat TAAAGCCCGGGACAGAATAGTTCTGTGGAAACTTAAGATAACG CGGGCTGCGAGTTACCTCAGCATAGCGAACAGCTTTATGATACTTTTTGTGTTTGCCAAGGAGCTATATTCCGTTCCATG GATTGCCTTGGGGTTCAGTTTCCGGGAGTTTGTCGGGGTTACCTACGCCCTTGCAGTCGTCGGTTTCATGCTCCTGGCGG AACTTGACTGGCACTTCATGTTCAAGAGGGAGCAGAGCTACGCCCTGACGAGGAATCCCCTTCTTCCGGCGCAGTGCTTT ATGATCGAATACCTTCTTCAGAAGGCGATTGAAGAGGGGAAAATATGTGAAAAAGAAGCCGAGAGGGTTTTATCTTCCCT CACGCTGGCCGGCTGCGATCTTCCTCGAGAGGAAGGACGAGTATCTCCCCGAAGGGCTCCTCCTGAATGAGGTCGACCTT CCCCATGTTCGAGAGGAAGAGCAGGTAGAGGAACGTCCTCGCCACTATCTTCGGGC