tg1171

Coordinates:1111525-1112196

>tg1171 Prokaryotic chromosome segregation and condensation protein ScpA related protein (ScpA)
MESRFETEITPVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMRELDLRVSARAILAASILVRMKTEALLSEDEGEEE
EKSEERIRVEVEPLAPPIRRSERYYTFDDLIEALMDALEEAERRKPRKRKKDNIEEQVFVVDDFRVDIEKHVHRLHGIVV
KLYRETGKPIRFWDLVFDPSPKIVARTFLYLLFLSNMGKVDLIQEEPFGEILVLPLEEDRSRPA

>tg1171 Prokaryotic chromosome segregation and condensation protein ScpA related protein (ScpA)
atggaatcgaggtttgaaaccgagataacgcccgtcgatatcctcctccagctcgtcaagatggggaaggttgacccctg
gaacatcgacatcgttgatctgaccgagaagtacataaagatgctgcgcgagatgagggagctcgacctcagggtttctg
cgagggctatcctagccgcctcaatcctcgtcaggatgaagacggaggctctgctgagcgaggacgagggggaggaagag
gagaaaagcgaggaaaggatccgggttgaggttgaacccctcgcaccgccaataaggagatcggagcgctactatacctt
cgacgacctcattgaggcactcatggatgcgctggaggaagctgagaggaggaagcccaggaagaggaaaaaggataaca
tagaggagcaggtgttcgttgtcgacgacttccgcgtcgacatagagaaacacgtccaccgactgcacggcatagtggtg
aagctctaccgtgaaacggggaagccaataaggttctgggatctcgtcttcgacccaagcccgaagatagtggcgaggac
gttcctctacctgctcttcctctcgaacatggggaaggtcgacctcattcaggaggagcccttcggggagatactcgtcc
ttcctctcgaggaagatcgcagccggccagcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1111025 - 1112696 (Additional range around tg1171 is :500nt.)

>Thermococcus gammatolerans EJ3 TAGCGAAGAACTTTTCGGAGCTCTTCGCCAAACTCTCACCCGGCGGGAGTGCAAAACTCATCCTTGAGAACCCGGAGGAT CCGTTCTCAGGAGGTCTGGAAATAGAGGCCAAGCCCGCCGGAAAGGACGTCAAGCGCATCGAGGCAATGAGCGGCGGCGA GAAGGCTTTGACGGCTTTAGCGTTCGTCTTCGCAATACAGCGCTACAAACCGGCCCCGTTCTACCTCTTCGACGAGATAG ACGCACATCTCGACGACGCAAACGTCAAGCGCGTCGCGGATTTAATAAAAGAATCCTCCCAGTCGAGCCAGTTCATAGTA ATAACCCTCAGGGACGTCATGATGGCCAATGCCGACAAGATCATAGGCGTCAGCATGAGGAACGGAATAAGCAGGGTCGT CTCGCTCAGCCTTGAGAAGGCCATGAAGATACTCGAAGAGGCCAGAAGACGGAGCGACGAGGAGCACAGGGAAATGTTCG GCCATCTGGAGGGCTGAGG atggaatcgaggtttgaaaccgagataacgcccgtcgatatcctcctccagctcgtcaag atggggaaggttgacccctggaacatcgacatcgttgatctgaccgagaagtacataaagatgctgcgcgagatgaggga gctcgacctcagggtttctgcgagggctatcctagccgcctcaatcctcgtcaggatgaagacggaggctctgctgagcg aggacgagggggaggaagaggagaaaagcgaggaaaggatccgggttgaggttgaacccctcgcaccgccaataaggaga tcggagcgctactataccttcgacgacctcattgaggcactcatggatgcgctggaggaagctgagaggaggaagcccag gaagaggaaaaaggataacatagaggagcaggtgttcgttgtcgacgacttccgcgtcgacatagagaaacacgtccacc gactgcacggcatagtggtgaagctctaccgtgaaacggggaagccaataaggttctgggatctcgtcttcgacccaagc ccgaagatagtggcgaggacgttcctctacctgctcttcctctcgaacatggggaaggtcgacctcattcaggaggagcc cttcggggagatactcgtccttcctctcgaggaagatcgcagccggccagcg TGAGGGAAGATAAAACCCTCTCGGCTT CTTTTTCACATATTTTCCCCTCTTCAATCGCCTTCTGAAGAAGGTATTCGATCATAAAGCACTGCGCCGGAAGAAGGGGA TTCCTCGTCAGGGCGTAGCTCTGCTCCCTCTTGAACATGAAGTGCCAGTCAAGTTCCGCCAGGAGCATGAAACCGACGAC TGCAAGGGCGTAGGTAACCCCGACAAACTCCCGGAAACTGAACCCCAAGGCAATCCATGGAACGGAATATAGCTCCTTGG CAAACACAAAAAGTATCATAAAGCTGTTCGCTATGCTGAGGTAACTCGCAGCCCGCGTTATCTTAAGTTTCCACAGAACT ATTCTGTCCCGGGCTTTAATGAGGCTCTTGGTTTTTATCATCGTCCTCATTACCAGCTGCACTCTCAAGACTGGCGATAA AGTTTTCTGAAAGAGCCCTTTCCTCCCTCTTCGCAGGCCTCAGCGTTATCGCGAGTAGGGGCTCCTCGCTACC