tg1174

Coordinates:1117811-1118041

>tg1174 hypothetical protein TGAM_1174
MQILEVDIKLPYRERGSVLSRLLSKVSGRIKDIHFLPPDATGMSEIRMELIGGKELVQELRKVVKIGKLSFKVLSEA

>tg1174 hypothetical protein TGAM_1174
atgcaaattctcgaagttgacatcaaactcccctatcgagaaaggggaagcgtgctgagccgcctcctttccaaggtctc
cggcaggattaaggacatacacttccttccgcccgatgcaaccggtatgtccgagatcaggatggaactgattggtggta
aagagctcgttcaggagcttagaaaagttgtaaagatcggaaagttatcattcaaggtgctttcggaagcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1117311 - 1118541 (Additional range around tg1174 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGCAACCGCAGCAGCCCAATCCTTGTCACTTCCACCGTAAGTCTTCTGCCACTTAACATTACCCTCGCTATCGAGCCTG AGAACCCAAACGTCGCCATAACCAGCTCCGAAGCTTTCAGTATAGCCTGCGACTATAATGTCTCCGTTTGGAGCAATAGC AACCGCGCGAGCCGTATCTTCACATTCCCCTCTGTATGTTTTGGCCCAGTGAGTGTTTTCTTCTGCAATCACCTTTCCCG CAGGAATCAGGGTCCCTAAGATGAGGAGGAGCCCCACGAAGACGAACATCCTCTTCATGGTGCCACCCCCTGGCATTAAT CATAGGTTTACTTCTGCTGTTTTTCACAATGAATTCTCTCCGAACCTTTATAAAAGCCATACTGACGACACTCGGTCGAT TTTCGATAACTGCTGAGAATATTTTTAACGGGGAACAATAATTTTGGCTCATGAAAAAGGTTTTATAGGCCTTCTTCTTT AAAATAAAACGGTGATGGCT atgcaaattctcgaagttgacatcaaactcccctatcgagaaaggggaagcgtgctgag ccgcctcctttccaaggtctccggcaggattaaggacatacacttccttccgcccgatgcaaccggtatgtccgagatca ggatggaactgattggtggtaaagagctcgttcaggagcttagaaaagttgtaaagatcggaaagttatcattcaaggtg ctttcggaagcc TAAAGGCTTTCTCCTTAGATTTTGACCCCCGAGTTTAACTCCTCAAGCTTTTTCCTTGCCTTCTCAA TCGAGCCAGCCTTTTCTACCGCAGTTCCTGTAACGATGATGTCGGCCCCCGCTTCAACCGCCCTCCTCGCCTGTTCCTTC GTCCGGATTCCACCCCCAACGATGAGCGGAACGTCTATGACCTTCCTAACGAGGGCAATCATCTCGGGCGGAACCGGCTG TGGGGCACCGCTACCCGCTTCAAGGTAAACGAGGCGCATGCCGAGGTACTGGCCGGCTAAGGCGTACGCGGCGGCGATCT TCGGCTTGTGTCTCGGTATTGGCTTCGCATCGCCGACCCAGCCGACGGTTTCGCCGGGCTCGATTATCAGGTAGGCCATC GGAATAGGCTCTATCCCATAGCGCTTGACGGTGAATGCTCCCAACGCCTGGGAGCCCGTTATGAAGAACGGATTCCGCGA GTTGAGGAGGCTCATGAAGAATATCGCGTCCG