tg1180

Coordinates:1121154-1121993

>tg1180 Acetyltransferase, GNAT family
MRVRLATLEDVHEIVEVHTADENLSGGIYDRYIRGGPWMATETLAIHLNNLLLDDQLVAVAELDGKIVGEVEVLFSEEPI
GGKVRRIAHIDVIEVHPDYRGRGIGRALMEFVEGLARERGAEMSTTQPDEDAKGFYERLGFDVEVFGGRTVWIPAGKRAD
DANIRPLEFSWEEVKNLQLVAGRFQSSYSMYFSAFKDNIAGIHYTVESGKAGESFYAFRNLPGRDGVALLLWGRIDDLGT
VLGRAKALGFERVLTVLAEDLEVADTREVGRIEILAKELT

>tg1180 Acetyltransferase, GNAT family
ATGAGGGTTCGTCTGGCAACCCTTGAGGACGTTCACGAGATAGTTGAGGTTCACACTGCCGACGAGAACCTCAGCGGCGG
CATTTACGACCGCTACATTCGGGGCGGCCCGTGGATGGCCACTGAGACGCTCGCGATTCACCTCAACAACCTCCTGCTCG
ACGACCAGCTTGTAGCCGTCGCAGAGCTTGACGGAAAGATCGTAGGGGAAGTCGAGGTTCTCTTTTCAGAAGAGCCCATC
GGGGGAAAAGTTCGAAGAATCGCCCACATTGACGTCATTGAAGTCCATCCTGATTACCGGGGCAGGGGAATTGGGAGAGC
GCTTATGGAGTTCGTTGAGGGCTTGGCCAGAGAAAGGGGAGCCGAGATGTCGACGACCCAGCCAGATGAGGATGCAAAGG
GCTTCTACGAGAGGCTGGGCTTTGATGTTGAGGTCTTCGGGGGCAGGACGGTGTGGATTCCTGCGGGTAAGAGAGCCGAT
GATGCGAACATACGGCCACTTGAGTTTAGCTGGGAGGAGGTTAAAAACCTCCAACTGGTTGCCGGCCGTTTCCAAAGCTC
TTACAGCATGTACTTTTCGGCGTTTAAGGACAACATAGCGGGAATTCACTACACCGTTGAAAGCGGAAAAGCCGGCGAGT
CCTTCTACGCCTTCAGAAACCTGCCGGGAAGAGACGGTGTTGCACTCCTCCTCTGGGGCAGAATTGACGATTTGGGGACA
GTTCTCGGCAGGGCTAAGGCTCTGGGCTTCGAGAGGGTACTGACCGTGCTCGCGGAGGATTTAGAAGTAGCAGACACGAG
AGAGGTTGGAAGAATAGAGATACTCGCGAAGGAACTCACC


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1120654 - 1122493 (Additional range around tg1180 is :500nt.)

>Thermococcus gammatolerans EJ3 CTGAAAGGGGAGGGAACTATGAGGAAGCGCGTTTTTCTGACTGACATGGACGAGGAGTGGATACTCTGGAGTGAGCTCAA GAGGCGCTATCCCGAGGCGAAGCTGAGCTACTCCACGATGGAAAGGAAGGCCGGGCTGGTGGTTCTGAGAACGGTTCCCG TTGAAGCGGTGCGGGAGATCATCGAGGAGCTTGGGCTCAACCTCGTCGCCGTCGATTCTGGCTTTGCAATCCACGTGAAG AAGCCCTGGATAAACAAGGGCGCAGGCATAGAAAAGGCCTGTGAGTACCTGGGTATTAAACCGAGCGAGGTCGCCCATGT TGGAGATGGGGAGAACGATTTGGACGCCTTCCGCGTCGTTGGATACCGGGTGGCAATCGCCCAGGCCCCAGAGAGCCTCA AGGAGAAAGCCGACTACGTAACCGAGAAACCGTACGGCGACGGTGGGGCTGAGGCGATAGTCCATATTCTAAGGAAGTTC GGCTATCTCGGTGAGGGCG ATGAGGGTTCGTCTGGCAACCCTTGAGGACGTTCACGAGATAGTTGAGGTTCACACTGCC GACGAGAACCTCAGCGGCGGCATTTACGACCGCTACATTCGGGGCGGCCCGTGGATGGCCACTGAGACGCTCGCGATTCA CCTCAACAACCTCCTGCTCGACGACCAGCTTGTAGCCGTCGCAGAGCTTGACGGAAAGATCGTAGGGGAAGTCGAGGTTC TCTTTTCAGAAGAGCCCATCGGGGGAAAAGTTCGAAGAATCGCCCACATTGACGTCATTGAAGTCCATCCTGATTACCGG GGCAGGGGAATTGGGAGAGCGCTTATGGAGTTCGTTGAGGGCTTGGCCAGAGAAAGGGGAGCCGAGATGTCGACGACCCA GCCAGATGAGGATGCAAAGGGCTTCTACGAGAGGCTGGGCTTTGATGTTGAGGTCTTCGGGGGCAGGACGGTGTGGATTC CTGCGGGTAAGAGAGCCGATGATGCGAACATACGGCCACTTGAGTTTAGCTGGGAGGAGGTTAAAAACCTCCAACTGGTT GCCGGCCGTTTCCAAAGCTCTTACAGCATGTACTTTTCGGCGTTTAAGGACAACATAGCGGGAATTCACTACACCGTTGA AAGCGGAAAAGCCGGCGAGTCCTTCTACGCCTTCAGAAACCTGCCGGGAAGAGACGGTGTTGCACTCCTCCTCTGGGGCA GAATTGACGATTTGGGGACAGTTCTCGGCAGGGCTAAGGCTCTGGGCTTCGAGAGGGTACTGACCGTGCTCGCGGAGGAT TTAGAAGTAGCAGACACGAGAGAGGTTGGAAGAATAGAGATACTCGCGAAGGAACTCACC TGAGGAACTCAAGGGCCAG GGCAACTTCCATCGCAGTTCCAAGGTGGAGGACGTCCTCGTCGACGTCAAACTTTGGATGGTGGTGCGGGTAGATAATGC CCTTCTCCTCGTTCCTTATTCCCAGGGCCAAAAACGCTCCCGGAACCCTCTGGAGGTAGAACGAGAAGTCCTCAGCTCCC ATCGTGGGCGGAACTTCGCCGTACTTCAGGCCGTATTTTTCCGCGACCTTCCGCGCGAACCCTGCCATCTCGGGGTCGTT GATCGTGGGAGGGGTTAGTTCATCGATGCTGAGCTCGTACTCAAGGTTGTGGGCAATGGCCACACCCCTGGCAATTTCGT CCATCCTCCTCTTTATCAGCTCGCCGACCTCCCCCTTGAAGAACCGGAAGGTGCCCTTGAACTCGGCCTTTTCTGGAATG ACATTGAAGGCCGTTCCCGCGTGAACCGAAGTAACGCTTACTACTCCGGTCTCGATCGGATCGACGTTCCTGCTAACTAT G