tg1183

Coordinates:1123737-1124420

>tg1183 Allophanate hydrolase subunit 1
MNFKPLGDSGLLISFGEVIDEETNDRVHALAGAIEKAGFEWLVEVVPSYSSLAVIYDAKLIDFEGVKQAIERIEFSAERF
EGRLVEIPVLYGGEHGPDLEFVAEYNGLTPEEVIEIHSRPIYRVYFLGFLPGFAYLGGMDERIATPRLEKPRLKVPAGSV
GIAGEQTGIYPIESPGGWRLIGRTPLRLFNPSRKPPTLLRPGDRVKFVPIDEEEFKELYKAEWGHEND

>tg1183 Allophanate hydrolase subunit 1
atgaacttcaagccccttggagactcggggttgctcatctccttcggagaggtcattgacgaagagaccaacgaccgcgt
tcacgccctcgcgggggcgatagagaaagcgggctttgagtggctcgtcgaagtcgttccctcttactcctccctcgccg
taatctacgatgccaagctcatagacttcgaaggagtcaagcaggcaatcgaaagaattgagttctcggctgagaggttc
gagggaaggctcgttgagattcccgttctttacggcggtgagcacggcccggatttggagttcgtagcggaatacaacgg
cctgactccggaggaggtcatcgagatacactccaggcccatctaccgcgtctacttcctcggctttctcccgggattcg
cctatctcggtgggatggacgagagaatagcaacgccccggctggaaaagccccgcctgaaagttccggcgggttcggtg
gggatagccggagagcagactgggatttatccaatcgagagccccggcggctggaggctcatcggcagaaccccgctgag
gctcttcaacccatcgaggaaaccgccaacgctcctgaggcccggcgacagggtaaagttcgtgccgattgatgaggagg
agttcaaggagctctacaaagccgaatgggggcacgaaaatgat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1123237 - 1124920 (Additional range around tg1183 is :500nt.)

>Thermococcus gammatolerans EJ3 GACAGGAACCTGATATTCGTGGCTCTCTCAGGCTCAAAACCGGCCCAGATAGCGGAGGAGATGGGCATTAAGGTGGCCCA CGAGGTCTTCGCTGACAGGGCATACAACCCGGACGGAACCCTCGTCCCCCGTTCGAAGCCCGGAGCGGTTATCCATGATA AGGAAGAAATAGCGGAGCGCGTGGTCTCGATGGTCAAGGACGGCGGGGTTAGAGCAATCAACGGCGAGTGGATTGAGCTC AGGGCAGATACAATCTGCGTCCACGGCGACAATCCGAAGGCCGTTGAGATAGCGAGGCAGGTCAGGGAGGTCCTTGAGCG GGAGGGGGTTAAGGTAGTGCCGATGGGGGAATTTCTGAGATGAACACTCAGAAGAAAGCCCCGAAGAAAGAAAACATGGA AGAGTTTCTGAGAGACCTTAACTCGGCGTTTGGAGCATTTACGGAGGACTTTGACCCTAGGAAGATTCGAAAGGAATGGG AGCGTGAATGGGTGAGACC atgaacttcaagccccttggagactcggggttgctcatctccttcggagaggtcattgac gaagagaccaacgaccgcgttcacgccctcgcgggggcgatagagaaagcgggctttgagtggctcgtcgaagtcgttcc ctcttactcctccctcgccgtaatctacgatgccaagctcatagacttcgaaggagtcaagcaggcaatcgaaagaattg agttctcggctgagaggttcgagggaaggctcgttgagattcccgttctttacggcggtgagcacggcccggatttggag ttcgtagcggaatacaacggcctgactccggaggaggtcatcgagatacactccaggcccatctaccgcgtctacttcct cggctttctcccgggattcgcctatctcggtgggatggacgagagaatagcaacgccccggctggaaaagccccgcctga aagttccggcgggttcggtggggatagccggagagcagactgggatttatccaatcgagagccccggcggctggaggctc atcggcagaaccccgctgaggctcttcaacccatcgaggaaaccgccaacgctcctgaggcccggcgacagggtaaagtt cgtgccgattgatgaggaggagttcaaggagctctacaaagccgaatgggggcacgaaaatgat TGAACTCCTCCGAGT TCCCTCTTTGCTGACGGTTCAAGACTCCGGCAGGAAGGGCTACCGAAAGCTTGGCGTCCCGGTTTCAGGCTACATGGACG ATTACTCAGCAAGGATAGCTAACTACCTCGTCGGAAACCCCTGCGATGCTCCCCTCCTCGAGTTCCTCCTGATGGGGCCA ACTATTAAGTTCAACGCTTCAGCGGTCTTCGCCGTTGCCGGTGACGTCGATGTGAAGCTCAACGGGGCTCCAGTTGATCC TTGGACTAGTTACTGGGCAAAGAGGGGCGACGTTCTCGAAGTAGGGGTGCTGAAGAGCGGTCTTTATGGCTACATAGCCT TTGCCGGAGGAATAAAGTGCGAGAAGCTTCTGGGTAGTTGCTCGACCTACGCCAGAGCTAACCTTGGACGGCCGTTGAGT GAGGGCGATAAACTTACCCTCGGCTACGCAATATTGACTGGCAAAGAGGGGTGCAGACTTCCCGAGGAGCTGAGGCCGGA CTACT