tg1188

Coordinates:1126989-1127519

>tg1188 Nucleotide kinase, shikimate kinase related
MIIAVTGTPGVGKTTVSKLLAEKLGYEYVSLRDYAIEKGIGEMKGDELEVEVDELTYNFERDFKGKNVVVDGHLSHFLNA
DLVVVLRAHPRLIGERLTERGYSREKVGENVEAELVDVILVEALEENENVIEVDTTGKTPEEVVNEILELIEKGVKKRVG
VVDWSEVYDEVIPYLRL

>tg1188 Nucleotide kinase, shikimate kinase related
atgataatcgcggtaaccgggacacccggggtggggaagacgacggtttcaaagcttttggcggaaaagctcggctacga
gtacgttagcttaagggactatgcgatagagaagggcatcggcgagatgaagggggacgagctcgaagtcgaggttgatg
agttaacttacaacttcgagcgagacttcaaggggaagaacgtcgtcgttgacgggcatcttagtcatttcctcaacgca
gacctcgtggttgtacttagggcgcacccgagactaatcggcgagaggttaaccgagaggggctattcgagggagaaagt
tggagaaaacgtcgaggccgagcttgtcgatgtaatcctcgtggaagcgcttgaggagaacgagaacgtcatagaggtcg
acacgacaggaaagacgccggaagaggttgtgaatgagattttagagctgattgagaaaggtgttaaaaagagggtcggc
gtcgtggactggagcgaggtttacgacgaggtgattccctacctgaggctc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1126489 - 1128019 (Additional range around tg1188 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGTCTCGGCGACGAGTGGGAGGAGGTCTATCAGCCTCCCCGCGAGCGGGCTCCTCATGAGGGCGATTCGCCTCTCCTTC TTCGTCGTGTGGACGGAAATCTGCATCTCGTCGAGGCCCGCTTTCCAGAGGCTCTCAATCCTTTTCTTGTCCAGCCCGAC GTTTCCAGCCGTGTCGGTAACCCGAATCCACAGCTCGGGATAGTGCTCGCTCACGTAGGCAATCCTCCTCTCGAGCTCCG GGTCGTTCAGGGTGTCGTGGAAGGAAACCTTGTAAATCATCTCGGGCGGATTCTGGCGGAGGTAGCAGAAGAGGCAGTAG CTCCCGCACGGGCCCGCTTTGCTCGACGGAGGGATAACCACCAAATCGTCCCGCTCATCGACGCCGTCCAGCTCGTACTT TGTGATTCGCCTGAGCTTGAAGTCCTCGGTGAACTCGTACATGCTCGAAACTCGGGCTGGGTTTTTAAAAGCTTAGGGTG AACCAAGTACGGTGGTGGC atgataatcgcggtaaccgggacacccggggtggggaagacgacggtttcaaagcttttg gcggaaaagctcggctacgagtacgttagcttaagggactatgcgatagagaagggcatcggcgagatgaagggggacga gctcgaagtcgaggttgatgagttaacttacaacttcgagcgagacttcaaggggaagaacgtcgtcgttgacgggcatc ttagtcatttcctcaacgcagacctcgtggttgtacttagggcgcacccgagactaatcggcgagaggttaaccgagagg ggctattcgagggagaaagttggagaaaacgtcgaggccgagcttgtcgatgtaatcctcgtggaagcgcttgaggagaa cgagaacgtcatagaggtcgacacgacaggaaagacgccggaagaggttgtgaatgagattttagagctgattgagaaag gtgttaaaaagagggtcggcgtcgtggactggagcgaggtttacgacgaggtgattccctacctgaggctc TGACTCCT TTTTCTTTGAAACTACCGCATTCAGACCATGTACAAACCTATTCAGGCCCTAACTGCACAGGATAATCCGCACAAGCTTT ATAATAGACTTTTTTTGGATAACAGTTCACCAATGGCATAGAGGTGGGGATGATGAAATTTAGAGCACTGTTTGTAGCAT TTTTGTTCCTTAGCGCCCTCCTGTGGATACCAACAACGGGGGCCAGCGCCTCAAATCTAAGCGGGTACACCATCTGCGTT GATGCCGGCCACGGTGGGAAAGACCCTGGTGCAGTCGGATACGTGGTGGAGAAGGACGTGAACCTGGCGATAGCTCTCAA AGTTGCCCAAGTCCTGGAAAGGGACGGTGCGAGGGTAGTCCTTACAAGGAACGGGGACTACTTCGTCACGCTCTCAGGAA GGGTACAGATAGCGAACTCAGCCGACTGTGATATCTTCATCAGTATACACGCCAACGCCGGGCCGAGCTCGGCGAGCGGA TTCGAGGTCTAC