tg1190

Coordinates:1128802-1129197

>tg1190 hypothetical protein TGAM_1190
MKLTIKPDRGFGKIEIEIDEALWAEIERLAERYRVPPERVAEIALIGEFGESKGELEELERKAEELEKRVWKLEKEYAPL
RYKAYGLSEDNKILAIELSGLIAENNQLRRFLRLPLNRNIELRKLISYYLQG

>tg1190 hypothetical protein TGAM_1190
atgaagctcacaatcaaacccgatagaggctttgggaagattgagatcgaaattgacgaggctctatgggccgagattga
gagactcgcggagcgatacagagtcccccctgagagggtcgctgaaatcgcccttataggggagttcggggagtcaaagg
gagagcttgaagagctcgagagaaaggcagaagagcttgaaaaaagggtctggaagcttgaaaaggaatacgccccgctc
cgatacaaggcctacggactgagcgaggacaacaaaatccttgcaatcgagctctctggcctgatagctgagaacaacca
gctgagacgcttcttgaggctccccctgaacaggaacatcgagctgagaaagcttatatcctactaccttcaaggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1128302 - 1129697 (Additional range around tg1190 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGGGGATAGCGAAGATTTTTGATAAAAAGCCGAAAGAAGTTAGAGAAAGGGACGTTAGGGAAATCATCGAGCCCTATGG GAAGTGGAAGGGTTTGCTGGCGTTTTACATCACCTGCTACGACAGGAAGACCGAGATGGAGAGGAGGAAGAGATGAGCGA TGTTGTGATTGTCCTTCCCCGCGAGAAGTTCAAATCCCTGAAGGGAAAAGACATTAGGGCCCTAATCGAGAGGAACCTGC CCAAAGTCGAGGAAACCCTCAGGGCCGAGAGGGAGGAGTTCCTTCGGGAGAAAATTGGAAAGCTCGAGGAGAAGCTCCGG GAAATGGAGGGTCAGCTCAACGAGCTGAGGGAGTTCTACAAGAAGGCCCTGAGAGACAAGGAGCTGATGATGGCGGAGCG CGATAAGCTGAGAAAGGAGAACGAGGAGCTCAGGAAAAGGCTTGATGAGAAGAGAAGTTCAGGAATAGTGAACGACTCGT TCACAGAGCGTGAACGAAG atgaagctcacaatcaaacccgatagaggctttgggaagattgagatcgaaattgacgag gctctatgggccgagattgagagactcgcggagcgatacagagtcccccctgagagggtcgctgaaatcgcccttatagg ggagttcggggagtcaaagggagagcttgaagagctcgagagaaaggcagaagagcttgaaaaaagggtctggaagcttg aaaaggaatacgccccgctccgatacaaggcctacggactgagcgaggacaacaaaatccttgcaatcgagctctctggc ctgatagctgagaacaaccagctgagacgcttcttgaggctccccctgaacaggaacatcgagctgagaaagcttatatc ctactaccttcaaggt TGAAGCGCGGATGATGACAGCGAATTGCACTGATGTTGATGACGAGGACTGGCCCTGACGCCG TCCCGGGCCGGCCGTGAGGAATCCAAGACGGGATGAGCGAAGGCGATGATATACCCTATGAGCGCCGAGCCGGTCCGGGG CGTTAAACTGCCCCAACCTTCTCAAGAACGCGCGGTATTTCAACCGGCTCAAGGGCGCTCTCGACGATGTAGCCCTTCTC CACGAGGATTCTCGAAACGAGCTCCTCTCGCGTGAAGCCGTCCAGTGTTCTGTCGCCGTAGAACATCAGCTCGGGAAGCA GGATAAGGCCAAGGTCGACCTCTGGAAGCTTTTCAACGGTTCTGAGAACGTCCCTGCCCGTGAGCAGGCCCGCCGTCCCT ATGTTCCCGCCGAAGAACTCGTTTTTAACCGCCACGACGGGAATCCTTGGGAAGATTCTTCTGAGTTCTGGATAGGCCAG CTCGCCCGTCAGTATGTACGTCGGCATCTCTGGCTCG