tg1197

Coordinates:1132356-1132655

>tg1197 hypothetical protein TGAM_1197
MVADGEEMEIKRIIEILDEKGEVSLETWKAISVKNNRDGTVDILYRNLHLGSDDDPVFLWIYANVVNDGDEDVRVLERIT
FKREDLAWILRYVPAKKGGK

>tg1197 hypothetical protein TGAM_1197
gtggtagcggacggtgaagagatggagatcaagaggataattgagatcctcgacgagaagggtgaggtaagcctcgagac
atggaaggcgatctcagttaagaacaaccgggacgggaccgttgacatactttaccgtaacctccaccttggcagtgacg
atgatcccgtgttcctgtggatatacgcaaacgtcgtcaacgatggggacgaggacgtcagggttcttgagagaataacc
ttcaagagggaagacctcgcatggatactccgctacgttcctgccaagaagggcgggaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1131856 - 1133155 (Additional range around tg1197 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCATAACCCCGAAGGGCCAGAGCTTCCTCGACAAGATCGCCACCGAGCTCAAGAAGGAGCTTGAGGAGCAGATTCCGGA GCTCAAGAAGTACTGAGCTCCCCTTTTCTCACATCCACCCAATACCTTTTTAACTTCCACTTCTGAGCCTGAAACGGAGG TGAGGAGCATGGCGGAGGACATAGAGGAGATCAGGAAGCGCAAGCTCATGGAACTTCAGAAGAGGTACCTCGAACAGCAG AAGGCCCAGGAGGAGGCAATAAAGCGGGAGATGGAGCTCCAGGCCCAGATTGACGCCATAATGAGAAAAATCCTGACCCC CGACGCGAGGGAGAGGCTCGGGCGCGTTAAGCTCGTCAAGCCCGAGCTCGCGAGGCAGGTTGAGCTCGTCCTCGTTCAGC TTTACCAGGCAGGCCAGATAAGGGAACCCATAGACGATGCCAAGTTGAAGAAGATACTGGCTCAGATCGACGCGAGGACG AGAAGGGAGTTCAGGATTAA gtggtagcggacggtgaagagatggagatcaagaggataattgagatcctcgacgagaa gggtgaggtaagcctcgagacatggaaggcgatctcagttaagaacaaccgggacgggaccgttgacatactttaccgta acctccaccttggcagtgacgatgatcccgtgttcctgtggatatacgcaaacgtcgtcaacgatggggacgaggacgtc agggttcttgagagaataaccttcaagagggaagacctcgcatggatactccgctacgttcctgccaagaagggcgggaa g TAAGTGGGAACATTTATAAGAGGCACTCGTATAGGGCCCGCCGTGGGGGTGTTTGGGTGAGTAAGAAGAGGGTCTGCC CCATCTGTGGTTCCACAGAGTTCATTTACGACCCCAGCAGGGGAGAGGTCGTTTGTAAAGTCTGCGGCTACGTCATCGAG GAAAACGTTGTCGATATGGGGCCCGAATGGAGGGCCTTTGACGCGAGCCAGAGGGAGAAGAGGGCCCGTGCAGGCGCCCC CGAGAGTATACTCCTCCATGATAAAGGCCTGTCAACCGACATAGGCATAGACCGCTCCCTCACCGGTCTGATGAGGGAGA AGATGTACCGTCTGAGAAAGTGGCAGTCACGCCTAAGAGTCAGCGATGCCGCCGAGCGTAACCTCGCCTTCGCCTTAAGC GAGCTTGACAGACTCGCCAGCAATCTCCGCCTTCCAAGGCACGTTGAAGAGGAGGCTGCAAGACTCTACAGAGAAGCGGT CAGGAAAGGCCTCATAAGGGG