tg1200

Coordinates:1134737-1135201

>tg1200 hypothetical protein TGAM_1200
MGVRMVRRHHDIGTFENLLLKWLGMLFDMVVIGLATITMGYVVYMMFHLVTDTIHALHVEDVLHQIVLVIIFLEIFELLT
MYVKEHHVSMRNVVELGVLAMVRKIIITPDYNQLGWQTLFGMAALIFVMGWIYVQERQRRTKHEEFLITHGIKKV

>tg1200 hypothetical protein TGAM_1200
gtgggtgtgcggatggtaaggagacatcacgacatcggcacctttgaaaaccttctgctcaagtggctcggcatgctctt
tgacatggtagtcataggtctcgcaacgataactatgggctatgtagtctacatgatgttccatctggtaaccgatacca
tccatgccctccatgtcgaagatgttttgcaccagatagtcctcgtcataatcttccttgaaatcttcgaactgctgacc
atgtacgtcaaggagcatcacgtcagcatgagaaacgtcgttgagctcggtgttctggcgatggtgaggaagatcataat
aacccccgactacaatcagctcggctggcagacgctctttggcatggcggctttaatattcgtgatgggctggatctacg
tccaggagagacagagaaggacaaagcacgaggagttcctcatcactcatggaattaagaaagtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1134237 - 1135701 (Additional range around tg1200 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCTTTCTTTCCGCACTCCTCAACGACCTGGGGGACGAACTTGGCTGGAACGACTATAACCGCCATATCCACCTCATCGG GGACATCGAGGATGCTCTTGTAGGACTTGAAGACGCGGTTGCCAATCTTTATCTCAACGCCCTTGATGTTGACGGGGTAT ATTTTGCCCTCGTAGCCGTACTCCACGAGGTTTTTCATAATCGCGTAGCCTATCTTTCCCGGTTTCTCCGAAGCGCCTAT GACGGCGATGCTCTTCGGCTTGAAAAGGGCCTCGATGTTCGGGTCAACCATTTTTATCACCTCGAATGACACTTACAGTT TTACGTCTGTAAAAGCCGTTAAAACCTTTCTCCTCTCTTTTTGCCGATGTTCAACTCGACGGACGTTAAAAAACCGCAGG TTTGAAACGGAACGTTCAGGGCCTTCCAGAGGGGAGATTAGGCTTTCAGATAACTTTTAGATTCTCCGAAAAGTTTTTAG AATAATCAATCACCTTTAG gtgggtgtgcggatggtaaggagacatcacgacatcggcacctttgaaaaccttctgctc aagtggctcggcatgctctttgacatggtagtcataggtctcgcaacgataactatgggctatgtagtctacatgatgtt ccatctggtaaccgataccatccatgccctccatgtcgaagatgttttgcaccagatagtcctcgtcataatcttccttg aaatcttcgaactgctgaccatgtacgtcaaggagcatcacgtcagcatgagaaacgtcgttgagctcggtgttctggcg atggtgaggaagatcataataacccccgactacaatcagctcggctggcagacgctctttggcatggcggctttaatatt cgtgatgggctggatctacgtccaggagagacagagaaggacaaagcacgaggagttcctcatcactcatggaattaaga aagtt TAGCCGATGACGACCCTTCCCCTCCCTGAGATGTGATGAGAACCCGGTAGACGGAGGCAAACCCTAAAATACCC CTTTCCCAACTTTTCTTGGGTGGTGAAGATGGGTGTCCAGATAGGCGAGCTGGTTCCGAGGAAGGAGATCGAGCTCGAGA ACCTCTATGGTAAAAAGGTCGCGATAGATGCGTTCAACGCCATGTACCAGTTTCTCTCAACAATAAGGCAGCGCGATGGA ACGCCGCTCATGGATTCAAAGGGCAGGATAACCTCTCACCTGAGCGGGTTCTTCTACAGGACGATCAACCTGATGGAGGC TGGCATAAAGCCGGCCTATGTCTTCGATGGCGAACCACCCGCTTTCAAGAAAAAAGAGCTCGAAAAAAGACGCGAAGCTC GCGAAGAGGCCGAGGAGAAGTGGCACGAGGCCCTTGAGAGGGGCGAGATTGAGGAAGCCAAGAAGTACGCCATGAGGGCG ACAAAGCTGAATGAAACCCTCATCGA