tg1203

Coordinates:1137674-1138387

>tg1203 Metallophosphoesterase, MJ0912 type
MVALIIALISDIHSNLEALEAVWNEIKDADAFLCMGDLIGYGASPNEVVDFVRRQMERRTFLCVRGNHDNAIAFGADWGF
NPYARQAVRWHQRVMTIENLEFLRRLPVRQLFEDDTGRSYILIHGSPRAPLDEYLFPWLPESEFKAVLSYVRQDDLLVGH
THVPMLKVIEGRRIINPGSVGQPRDGNWRASYAIIDTEREPPDNIEFHRVEYDVEEAARKIIEAGLPMFLANRLFEGY

>tg1203 Metallophosphoesterase, MJ0912 type
gtggtggcattgatcatagcgctcatcagcgacatccactcgaacctggaggcgctcgaagctgtctggaatgagatcaa
ggatgccgacgctttcctctgcatgggtgacttgatcggttacggggctagtccaaacgaggtcgttgactttgtgaggc
gacagatggagaggagaaccttcctctgcgtccgcggaaaccacgacaacgcgattgccttcggggcggactggggcttc
aacccctacgcgaggcaggctgtacggtggcatcagcgggtcatgacgatagaaaacctcgagtttctccggcgactgcc
ggtgagacagctttttgaggacgacacaggaaggagctacatcctcattcacggctccccgagggctcccctggacgagt
acctcttcccctggctccctgagagtgagtttaaagcagttttgagctacgtccgtcaggacgacctcctagtcggccac
actcacgtgccaatgctgaaggtgatcgagggaaggaggataataaaccccggatcggtgggccagccgagggacgggaa
ctggagggctagctatgcgataatcgatacggaaagagaaccaccggacaacatcgagttccaccgtgtggagtatgatg
tagaagaagccgccagaaagataatagaggcgggtctgccgatgtttctggccaataggctcttcgagggttat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1137174 - 1138887 (Additional range around tg1203 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGGGAAACCTGACGGTCTACACTGTCAAAACGTACCTCTCCAACGTTACCCGCCCAAACGTCACATACGATATTGGGGG CTACCTCTTCCTAGGCGATTACAGCCTGCCCCTCAGGGAGTTCTACATGAGGATCTCGGGCAGGGTGAACCCAAGGGTCA CGACAAGGCTCGAACTCTCCCTCGCGGAGAATTTTGGGACGTATGAGGCCACTTACCTCAACGGCACCCTCCATCTGGGG GATGTACTCTACCAGAGGTCCCTTGAGGGAATACTCGTGAAGAACGGGACGCTGGTCAGGGAAATGGTCGTTTACGATAA CCCTGCCCCTTACCTCAGGTTTAAAAACTGCGTTGAGCACTACAACGAAACCTTAGAAGCCTGCCGGGCCAGCGGCTCCC CGGAGTACCAGCTTCCCCTCGGGCTCGGCCTCATGCTCGCGGGCATCGCCCTCTTCGCTTACGGGATGAAGTTTTAAGTC CCTTCCCCCATTTTCCTTCG gtggtggcattgatcatagcgctcatcagcgacatccactcgaacctggaggcgctcga agctgtctggaatgagatcaaggatgccgacgctttcctctgcatgggtgacttgatcggttacggggctagtccaaacg aggtcgttgactttgtgaggcgacagatggagaggagaaccttcctctgcgtccgcggaaaccacgacaacgcgattgcc ttcggggcggactggggcttcaacccctacgcgaggcaggctgtacggtggcatcagcgggtcatgacgatagaaaacct cgagtttctccggcgactgccggtgagacagctttttgaggacgacacaggaaggagctacatcctcattcacggctccc cgagggctcccctggacgagtacctcttcccctggctccctgagagtgagtttaaagcagttttgagctacgtccgtcag gacgacctcctagtcggccacactcacgtgccaatgctgaaggtgatcgagggaaggaggataataaaccccggatcggt gggccagccgagggacgggaactggagggctagctatgcgataatcgatacggaaagagaaccaccggacaacatcgagt tccaccgtgtggagtatgatgtagaagaagccgccagaaagataatagaggcgggtctgccgatgtttctggccaatagg ctcttcgagggttat TAACGGTGTCTTATTCCCCGGAGCTTCGATTTTACTGCCAGCTTGCTGGAATCGATGATTATGA CCTCACCGATGCTCCGTACCGCACTCACTGGGATTAGAAGAAGACCCTCATGGTCAGTGACGAACTCGCTCGTGTCAAGA TCCTCGTCCGGTTCCGCGACTATAACGAGGAGTTCCCCGGTTTTCTCGTCGAAGCTGAGATCGTAAACCCATCCAAGCCT GATTCCCGTGTCCGTGATAAGCTCGACGTCCCTGAGCTTTGAAGCGAGTATCTTAACCATCTTCAACACCCCTCCATTTT ACGGTGTGCTTAAATCATCACGATCGTATAAAACTTTTTCCACACGGCGATACAGAATCGAAAACCAAAAAGTCTATCAA TGATGGGAGTGAGCTAACCCGGGCGATGAAGAGATTCATCCCTCCTGACGGGGACTCGCTCCCCCCGAGATGAAGACGCG GTCCCCCCTCGAGCCCCTTTTAGTTCTCCTCCGAT