tg1204

Coordinates:1138390-1138671

>tg1204 hypothetical protein TGAM_1204
MVKILASKLRDVELITDTGIRLGWVYDLSFDEKTGELLVIVAEPDEDLDTSEFVTDHEGLLLIPVSAVRSIGEVIIIDSS
KLAVKSKLRGIRHR

>tg1204 hypothetical protein TGAM_1204
atggttaagatactcgcttcaaagctcagggacgtcgagcttatcacggacacgggaatcaggcttggatgggtttacga
tctcagcttcgacgagaaaaccggggaactcctcgttatagtcgcggaaccggacgaggatcttgacacgagcgagttcg
tcactgaccatgagggtcttcttctaatcccagtgagtgcggtacggagcatcggtgaggtcataatcatcgattccagc
aagctggcagtaaaatcgaagctccggggaataagacaccgt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1137890 - 1139171 (Additional range around tg1204 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGAAAGTTTAGTGCGAGAGCTCGCGGAGGAACTCAACATTAAAACCATCCTCGATAAGCATCCGGACCAGCTGAGTGGG GGTGAGCTAAAGAGGGCTGAGTTGTTGATGGTGCTTTCTGATGATCCGGGTCTCTTGCTCCTCGACGAGCCGACTTCGAT GCTTGACGCGGAGAATTCGGAGGCTGTTGTTAATGTTCTCTCAGCGCTCAAGGGGAGGGTTCCAATGATAATCACCTCCC ACGATCCAAGACTACAAAAAATCACCAACAAAACACTAGAAATAATCGGAGGAGAACTAAAAGGGGCTCGAGGGGGGACC GCGTCTTCATCTCGGGGGGAGCGAGTCCCCGTCAGGAGGGATGAATCTCTTCATCGCCCGGGTTAGCTCACTCCCATCAT TGATAGACTTTTTGGTTTTCGATTCTGTATCGCCGTGTGGAAAAAGTTTTATACGATCGTGATGATTTAAGCACACCGTA AAATGGAGGGGTGTTGAAG atggttaagatactcgcttcaaagctcagggacgtcgagcttatcacggacacgggaatc aggcttggatgggtttacgatctcagcttcgacgagaaaaccggggaactcctcgttatagtcgcggaaccggacgagga tcttgacacgagcgagttcgtcactgaccatgagggtcttcttctaatcccagtgagtgcggtacggagcatcggtgagg tcataatcatcgattccagcaagctggcagtaaaatcgaagctccggggaataagacaccgt TAATAACCCTCGAAGAG CCTATTGGCCAGAAACATCGGCAGACCCGCCTCTATTATCTTTCTGGCGGCTTCTTCTACATCATACTCCACACGGTGGA ACTCGATGTTGTCCGGTGGTTCTCTTTCCGTATCGATTATCGCATAGCTAGCCCTCCAGTTCCCGTCCCTCGGCTGGCCC ACCGATCCGGGGTTTATTATCCTCCTTCCCTCGATCACCTTCAGCATTGGCACGTGAGTGTGGCCGACTAGGAGGTCGTC CTGACGGACGTAGCTCAAAACTGCTTTAAACTCACTCTCAGGGAGCCAGGGGAAGAGGTACTCGTCCAGGGGAGCCCTCG GGGAGCCGTGAATGAGGATGTAGCTCCTTCCTGTGTCGTCCTCAAAAAGCTGTCTCACCGGCAGTCGCCGGAGAAACTCG AGGTTTTCTATCGTCATGACCCGCTGATGCCACCGTACAGCCTGCCTCGCGTAGGGGTTGAAGCCCCAGTCCGCCCCGAA GGC