tg1214

Coordinates:1146029-1146385

>tg1214 hypothetical protein TGAM_1214
MKIYTPDRKWPEPYKAVIEELRKITDPVTGGDILDSGVIAGLEVSDDTLKIWLRFESHAEYNIIGETPIAYSKIIGDIME
RFALIKFNNVYVYDLGNNIVGKFENKKGYKPEDLSPEKV

>tg1214 hypothetical protein TGAM_1214
atgaagatctacaccccggatagaaagtggcccgagccatataaggccgtcatcgaggagctgaggaagataaccgatcc
cgttaccggcggcgatattctcgattctggagttatagccggccttgaggtgagcgacgacacgctcaagatctggctcc
ggtttgagagtcatgccgaatacaacattatcggagagaccccgatagcctactccaagataatcggggatataatggag
cgcttcgccctcatcaagttcaacaacgtctacgtctacgacctcggcaacaacatcgttgggaagtttgaaaacaagaa
aggttacaaaccggaagacctcagtcctgaaaaggtg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1145529 - 1146885 (Additional range around tg1214 is :500nt.)

>Thermococcus gammatolerans EJ3 AATCCTAACGGCTATAGGCTTCGTGGCCTACGCCTGCAGGACAACACACTCATGGGAGGCCTTTCTCGTAATGTTTGGTC CCGTTCTTATAGCGTACACTCTCTCGGAGAGCGGTCTGGTTCAGCCTAAGCTCGAGATGCTCGTTCAGGCGACGGTAATG GTGGCTTCGATCGGGATAAGCGCCCGTAAGTCCCATTACGCCATCATGATGTTCTCGGCCCTCTCAATCCTGCTGATGAT AGACGCGGTCGCCTTTTACCGCTATATTCCCCAGCCGCACGGAAAGATAGCGAGGATCTCCGCATGGCTCTTTGTGGCAT TTACCCTCGTCAACGCTGTAAACTACGGCAGTTTAATCGCGTTCGCGATGTACTTCCTCTCCATTGTCCTCTGGGTCGGA ACGCTCCTCGGCCTCGAGCTTTATCTCACGCGCATTGACGTGGACAGATCTGGCCAAAAAGCCTTATAACTGCCCTCTCA AACTCCCTCCGGTGAGAAC atgaagatctacaccccggatagaaagtggcccgagccatataaggccgtcatcgaggag ctgaggaagataaccgatcccgttaccggcggcgatattctcgattctggagttatagccggccttgaggtgagcgacga cacgctcaagatctggctccggtttgagagtcatgccgaatacaacattatcggagagaccccgatagcctactccaaga taatcggggatataatggagcgcttcgccctcatcaagttcaacaacgtctacgtctacgacctcggcaacaacatcgtt gggaagtttgaaaacaagaaaggttacaaaccggaagacctcagtcctgaaaaggtg TGATAGATGGGATTACTGAGCT TTCTGCGGTCCAGAAAACAGAAAGTAACAGGATCAAAGAAATATCTGCCCGGGGAAGTCAGGAAGGTCGTTCGAATCCTT GAGGACATTGATGACCCTGAAACCGGTCTGAACGTGGTTGAGGAGGGACTCGTTTACGGCCTCACAGTTGAAGGGAAACG CGTCGAGGTCTTTCTCCTAATGGCTCGCTCCACCCCCGAATGCCATTTCTGTCGAATGCTCGCCATAAACGTTCAGAACA GGATCCTGAGGGACGTTGTGGAGGCCCTAAAGAAAGAGGGCTTTGAGAGGGTTAAAGTGTACAACGAACTGGGCCTCCTG CTCGCGGAGGGGTGATCACTCCTCCAAGTAGGGTACCCTCGGCTTTCGGAACAGCTCATCTAGCTCTGCCCTTCTTTTCC TGACCTTCTCGTAGAGCTCTCCGACTCGGGGATCATCGACTTTTGACTTCAGTGCGAGCAATATGCCCTCGAGGAAGC