tg1218

Coordinates:1147983-1148771

>tg1218 Short chain dehydrogenase of unknown substrate
MIGIDLSGRLAFTTASSKGIGFGVARVLARAGADVILLSRSEENLKKAREKIMSESSVDVSYIIADLTKREDLERTVREL
SEIGEPDVFFFSTGGPKPGYFMEMSMEDWEKAVRLLLYPAVYLTRAIVPAMERKGFGRIIYSTSVAIKEPIPNIALSNVV
RISMAGLVRTLAKELGPKGITVNGIMPGIIRTDRVIQLAEDRAKREGKTIEEALAEYAKPIPAGRLGEPEEIGYLVAFLA
SDLGSYINGAMIPVDGGRLNSVF

>tg1218 Short chain dehydrogenase of unknown substrate
atgataggaatagacctctcgggcaggctggccttcacaacggcgtcgagcaagggaatcggctttggggttgcgagagt
cttagcgagagccggtgcggacgtcatactgctctcgcgcagcgaggagaacctcaaaaaggcgcgggagaagataatga
gcgagagcagcgttgacgtgagctacatcatcgccgatctgaccaagagggaagaccttgagcgaactgtgagggaactc
tccgagataggagagcccgacgtgttcttcttctcgacgggcgggccgaagccgggttacttcatggagatgagcatgga
agactgggaaaaggccgtgaggctgctcctgtacccggcagtttacctcacgagggccatcgttccggctatggagcgta
agggattcgggagaatcatttactcgacgagcgtcgctataaaggagccaattccgaacatagccctgagcaacgtcgtc
agaatttcgatggctggtctcgtgagaaccctcgcgaaggagctcggtccaaagggcataacggtgaacggaataatgcc
cggcataataagaaccgacagggtgattcagctcgcggaggacagggcgaagagggaaggaaagaccatcgaagaggccc
ttgcggagtacgcgaagcccataccagctggaaggcttggggagccggaggaaataggatacctcgttgcgttcctcgcc
agcgacctcggttcttacatcaacggggccatgattccggtggacggaggaaggctgaattccgtcttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1147483 - 1149271 (Additional range around tg1218 is :500nt.)

>Thermococcus gammatolerans EJ3 GTTCCGCGATCTAAAGGTCCCGGAGAACGGTGTTGTTACCGTCGTTATAGGGACCGACTGGAACCACTACCACGCCAATA TCGCGAGAACGTTCACCGTTGGTGAACCCGGCGGGAGGGTCAGGGAGGCGATGGACGTCAAGAAGGAAGCTTACGAACTC GCCCTACGGGAGACGAAGGTTGGCGTTGTATTGAACACCGTTGAGAGAAAGCTAGCTAGCTTCTTCAGGGAGAGGGGATT CGGCGATGCTTACATAGCCGGTTACACCCACAGCGTCGGCCTTCTAATCGAGGAACTCCCGATGCCCACGATAGTTGTGC CCACGAGGGCAGAAAAGGTTCGCGAGAACATGGTTCTGAGCATCGTCCACTCCCCGCTAATGATTCCTGAGGGTGCTATA AAGCACGAGGATACTTACATCGTCAAAAAGGACGGGCTGGAGAAGGTGACCTGACACAAAAGATTTAGGGAGAAAGGCCA ACTCTTCACGGTGGTTGCT atgataggaatagacctctcgggcaggctggccttcacaacggcgtcgagcaagggaatc ggctttggggttgcgagagtcttagcgagagccggtgcggacgtcatactgctctcgcgcagcgaggagaacctcaaaaa ggcgcgggagaagataatgagcgagagcagcgttgacgtgagctacatcatcgccgatctgaccaagagggaagaccttg agcgaactgtgagggaactctccgagataggagagcccgacgtgttcttcttctcgacgggcgggccgaagccgggttac ttcatggagatgagcatggaagactgggaaaaggccgtgaggctgctcctgtacccggcagtttacctcacgagggccat cgttccggctatggagcgtaagggattcgggagaatcatttactcgacgagcgtcgctataaaggagccaattccgaaca tagccctgagcaacgtcgtcagaatttcgatggctggtctcgtgagaaccctcgcgaaggagctcggtccaaagggcata acggtgaacggaataatgcccggcataataagaaccgacagggtgattcagctcgcggaggacagggcgaagagggaagg aaagaccatcgaagaggcccttgcggagtacgcgaagcccataccagctggaaggcttggggagccggaggaaataggat acctcgttgcgttcctcgccagcgacctcggttcttacatcaacggggccatgattccggtggacggaggaaggctgaat tccgtcttt TGAACTTTCTTTATCTTGAACAAAAATCTTTTAAGTTCTAATCTCGAATTTAAAAGTAGAAAAATAGAAC TGAGGTGAGGAGATGCCCTACGCAGGATTCGCGAGAACGACGGAGGGACCTTTAAAAACCTTTGAGAGAATAATGGAGGA ACTGAAAAAGCGGGGCTTTGAGGTGAGCTTTGCCAAGCACCACTGGGCCGGTGACATGCCCTTCGGCCTCATAATAGCCG AGACGAATAAGGGCCCGCTGGTGATCAGGTGGAGCCTTGGAAAGAGGTTCGAGCTCAGGATCGAGGAGATCGACGAGGAT GCCTTTGAGGATCTTATAGATGAGACCCTAGACTACATCGGTGGTGACTGAAGTATTAAACAAAACTCGAAAAAGTTAAT TGCTCAATTACATAATACTGCAATTGAAGGTTTTGTTTTTCCACTTCACGGGTTTGAACCACAAACCTTATAAGGCCGAA TAAACAACATAAGTTCGATGCTAAGACATT