tg1220

Coordinates:1150399-1150857

>tg1220 Peroxiredoxin, bacterioferritin comigratory protein-like protein (bcp)
MNYLNIAVFDEDGTEKPLKDLVLGRWTVLYFYPKDNTPGCTTEAREFTELIDEFEKLGFQVIGVSRDLPKSHARFKEKHN
LKVRLISDPNAELHRALGVWGKKKRYGREYEGAIRSTFILDPNGKIVWEKRNVRAKGHAAKVLEVAKGLIGKE

>tg1220 Peroxiredoxin, bacterioferritin comigratory protein-like protein (bcp)
atgaactatctaaatattgcggtcttcgacgaagacggaaccgagaagcccctgaaggatctggttctcggcaggtggac
ggttctctacttctatcccaaggataacacgcccggctgtacgaccgaggcaagggagttcaccgagctcatagacgagt
tcgaaaagctcggctttcaggtgattggcgtctcaagggatttgccaaaaagccacgctcgcttcaaggagaagcacaat
ctgaaggtaaggctcattagcgatccgaacgctgagctccacagggctttgggggtgtggggcaagaagaagcgctacgg
aagggagtacgagggagcgattaggagcacctttatactggatcccaacgggaagatagtctgggagaagcgcaacgtcc
gcgcgaagggtcacgcggcgaaagttttggaagtggccaaaggcctaatcggcaaagaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1149899 - 1151357 (Additional range around tg1220 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCCTCCAATCAAGTAGTCTCTTCTCGCCCTCTATCCTTTTATACTCTCCGATGCCCCCAGTAATCTTCAGGGTTCCCAG GTAGTTTCCGTTTTTGTCAATGAGGGGACATACTTAATGAGATGTACTTCCGGCCAAACCTGAGCCAGAACGTTGCCTCT TTTTCCTTCCTCCTTAAAAAGCCCACAAGATTCGTCCCTGTCTATAACGGTAACGTCAACGAGAGGGGGCCATCAAATAT ACCCTTAAGCTTCTCGATGCTCACGAAACCGGTACCAAGATCTATGCCCCCGCGCCTCAGCCGGCCGTTATCAACCCAGG GCGGTCCTTAATGATCTGCTGGACGTCCTTTGAAAGGCTGAGAAGTTCCTCCGCACTCAAAGGGTTGGAGACCCTCTTAA TCTTCGTGGTCTTCCCCTGATACCCGATAATGAATCGGGATTCTAACGCTTGTGGCGAAAGGTTTATCAATTAGGGCGAC CTAATTAAAACGGTGATCGG atgaactatctaaatattgcggtcttcgacgaagacggaaccgagaagcccctgaagga tctggttctcggcaggtggacggttctctacttctatcccaaggataacacgcccggctgtacgaccgaggcaagggagt tcaccgagctcatagacgagttcgaaaagctcggctttcaggtgattggcgtctcaagggatttgccaaaaagccacgct cgcttcaaggagaagcacaatctgaaggtaaggctcattagcgatccgaacgctgagctccacagggctttgggggtgtg gggcaagaagaagcgctacggaagggagtacgagggagcgattaggagcacctttatactggatcccaacgggaagatag tctgggagaagcgcaacgtccgcgcgaagggtcacgcggcgaaagttttggaagtggccaaaggcctaatcggcaaagaa TAGAGGGGGTGCTTTTATGGACGAGCTTGAGGCTTTAGCTTTAGCCCTGGAGGTTGAGAAGGCAGAGATGCGCTTTTAT CTCGATCTCGCAAGGCGGACGAAGGACGAGAAAGCTAAGAAGATGTTCCTTTTCCTCGCCAAGGAAGAGGCCGACCACTG GGAACAGTTCGAGGAGAGGTTCCTCGAGCGCGTTGCCGAGGAGTGCAAGTTGCCAGCCGTAAGCGAAGAGCTCCTCGAAA AGCTCCTCGTCAAGGCTGAGGAGATTGAAAGCGAAGTCGATGCCGTGAGGATTGGAATGGAACAGGAAAAGCTCACGTGG GAGTTCTACGAGAGGGCCGCGAAGGAAGCAAGGCACGATTCAGTTAGGAGGCTCTTCGAGGAGCTGGCGAGGATAGAGAA GGCCCACTACGAGCTACTCAAAGCCCAGTACGACGCGGTCATGAAGACGGGCATCTGGATGGACTACCAGGACTTCAGCC TTGAGGTTGATTGACGCTTT