tg1227

Coordinates:1155720-1156328

>tg1227 ABC transporter, ATP-binding protein
MKNLRKSFNELILDEVSLEVSAGEVIGLIGPNGTGKSTLVKILAGVIEPDSGEVFVKNPSVLYQEDYLLPWKRLRDNVCL
PARFRGRECRLEYVERLGLESYLDLYPKEVSGGTRRKASILRALLMDFDVLILDEPFTGLDARSKEELLFIIRELANSGK
GVLVVSHQLEELFKVADRVYLIGGRPAKIKKVLGREELGKGTF

>tg1227 ABC transporter, ATP-binding protein
gtgaaaaatctgagaaagtccttcaacgagcttatactcgacgaggttagccttgaggttagcgcgggagaggtgatcgg
cctcatcgggccgaacgggactggaaagagcaccctcgtgaagattttggcgggtgtcatagagccagactcaggcgaag
tctttgtaaagaacccatccgtcctctatcaggaggactaccttttgccgtggaagaggctgagggacaacgtctgcctg
cccgcccgcttcaggggtagggagtgcaggctcgaatacgtcgagaggctcggcctggagagctacctcgacctctaccc
aaaggaggtcagcggggggacgaggaggaaggcttccatcctgcgcgccctgctcatggacttcgacgttctgattctgg
atgaaccttttactggcctcgacgcgcgttctaaggaagaacttcttttcataattcgggaattagccaattctggaaaa
ggtgttctggtcgtctcgcaccagctcgaggagctcttcaaggtcgccgacagggtttacctcataggaggaagacccgc
gaagataaagaaagtccttgggagggaggaacttggtaaaggaactttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1155220 - 1156828 (Additional range around tg1227 is :500nt.)

>Thermococcus gammatolerans EJ3 CAAGGGCCTTCAGGGACTTTCTGAACGCTTTAAACGTCTTCCTCCAGAGCGTCTCGGTTCTCGTCTGGACGATAGTCTTC ATAATGCTCTTCGGCGTTACGAGTTCAATCGCGACGATACTCGTTACCGCGATGGCATCTTTTCCAGCACTGCTTTCGGC TGGGGTGAGCTCAAGCGAAAAGGTGATAGAAAAATACCGCCCGCTGGTGGTCCTGCTCAAACCCTCAAAGCTTCAGCTCT ACCGGCACTTCATCGTCCCTGGAACGCTCCCCGAGATGGTTTCGGCAGGCAGAGTGGCCCTGGGAATAGCGCTCAGGATA AGCGTCGTTGCCGAGGCCTTTGGCTCTGCCGGCGGAATCGGCTACCAGCTCGTCTACTCCTACGATTTGGGAATCAAAGC TGGAGTCTTCGCGTGGGCGTTGCTCTTAATCCTTCTCATGATAACCCTCGACCAGTTGCTCCTCAGGAGGCTCGAGGAAT GGGTGAAAGGCTGGTACTG gtgaaaaatctgagaaagtccttcaacgagcttatactcgacgaggttagccttgaggtt agcgcgggagaggtgatcggcctcatcgggccgaacgggactggaaagagcaccctcgtgaagattttggcgggtgtcat agagccagactcaggcgaagtctttgtaaagaacccatccgtcctctatcaggaggactaccttttgccgtggaagaggc tgagggacaacgtctgcctgcccgcccgcttcaggggtagggagtgcaggctcgaatacgtcgagaggctcggcctggag agctacctcgacctctacccaaaggaggtcagcggggggacgaggaggaaggcttccatcctgcgcgccctgctcatgga cttcgacgttctgattctggatgaaccttttactggcctcgacgcgcgttctaaggaagaacttcttttcataattcggg aattagccaattctggaaaaggtgttctggtcgtctcgcaccagctcgaggagctcttcaaggtcgccgacagggtttac ctcataggaggaagacccgcgaagataaagaaagtccttgggagggaggaacttggtaaaggaactttt TGACAGCATC GCGGAGCGCTACGACTTGACCAACAGGCTGATAAGCCTCGGCCTTGACAAACTCTGGCGTAGGAAGGCCTGCGAGGAGGT TTTAAAGTTCATAGAAGTTCAAGAAAGGCCGTTAAAAATCCTCGACGTTGCATGTGGAACGGGGGACATGATACTCTGTA TGAGGAGGAGCCTTGAAAAAAGAAATTTATCGGGGGAGTTCTACGGCCTCGACTGCAGTGAGGAGATGCTCAGGATAGCG AGGAGGAAGGTTCCCTTTGCGAAGCTGAGCGTTGGAACCGCTGAGGAGATGCCCTATCCCGATGAGGGTTTCGATGTTGT TAGCATCGCATTCGGCATAAGGAACTTCTCCGACAGGGAGCGGGCAATAAAGGAACTCCACCGAGTTCTGAAGCCCGGAG GAAAGCTCCTAATCCTTGAGTTCTCAAAAAGCCCATCGCTCCTGGGGAAGATGGCCTGGCTATACACAAGAACTGTGGTT CCCATCATCG