tg1230

Coordinates:1158022-1158915

>tg1230 4-hydroxybenzoate polyprenyltransferase, putative (UbiA)
MAFDPGEVSKASRFHALMRLVRIEHTLFSLPYAYVGAFLSGFHVTWAEIILMSLALLGLRTAALAYNNIADLDIDSQNPR
TWNRPLIKGSVKVSDAWWLVVVGSVVYFVSAVLLNRWTALLSPIPWLIAMSYSGAKRKHSFPHLHLGLTLALAVAGGTIA
AGGNAPFIEVLARVPWAFFFGVLFWVAGFDTIYAIMDYEFDAEHGIGSIPARFGIENALKIALAFHLLAIALFGLAGFLY
DLGWVYLAGWLVGSALILYENLIVWKSLDNVPKAFNLNIPIGLILTLSAIADKLLGGV

>tg1230 4-hydroxybenzoate polyprenyltransferase, putative (UbiA)
atggccttcgaccccggtgaagtcagtaaagcgagcaggtttcacgcgttgatgaggctcgtcaggatagagcacacgct
cttcagcctgccctacgcttacgtcggggcgttcctcagcggtttccacgttacctgggccgagataatcctgatgagtc
ttgccctcctcgggcttagaacagctgcactggcctacaacaacatagccgacctcgacatagacagccagaacccgagg
acgtggaacaggccgctgattaaggggtcggtgaaggtgagcgacgcctggtggctcgtcgtcgttggctcagtggttta
cttcgtttcggcggttctcctcaaccgctggactgctttactaagcccgattccctggttaatagcgatgagctactcgg
gggcgaagaggaagcacagcttcccccatctccacctcggattaacgctcgccctggcggtcgctggaggaacgatagca
gctggaggaaacgctcctttcatagaagtcctcgcgcgggttccctgggcgttcttcttcggcgtcctcttctgggtggc
gggctttgacacgatatacgcgataatggactacgagttcgacgctgagcacggaatcgggagcattcccgctaggtttg
gcatagagaatgccctcaaaattgccctcgccttccaccttctcgctatagccctctttggccttgctgggttcctctac
gacctcggatgggtttacttggctggctggctcgttggaagcgctctaatcctctacgagaacctaatcgtctggaagag
ccttgacaacgttccaaaggccttcaacctcaacattccaatcggcctaatcctcacgctctcggccatagcggacaagc
ttttgggaggggtt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1157522 - 1159415 (Additional range around tg1230 is :500nt.)

>Thermococcus gammatolerans EJ3 CCGTTGGAAGATGCCGTAATCGGAAAGGCTATCGAGAGGATTTTCCTTCCGTTGATGAGGGTCGTCCTGCCCGAGGTCGT TGATGTGAACTTCCCAGAATATGGCGTCTTTCAGGGTGTCGCGATAGTCTCGATAAAGAAGCGCTACCCCGGGCACGGAA AAAAGGTTCTCAACGCGCTCTGGGGAACGGGACAGATGGCGCTGACGAAGGTCATAGTGGTTGTCAGCGAAGACATAAAC CCCCACGACATAAACCAGGTGATATGGGCAATAGCTTCCTTCGTGAACCCCGAGCGGGACGTTCTGGTGATTCCAAAGGC ACACACAGATGCGCTCGACCCGGCCGTTCCGAGGCCCCCGCTCGGGAGCAAGCTCGGAATTGATGCGACCAGAAAGTTCC CCGAGGAGATGGACGGCAGGGTCGTTGAGGAGGTTAAAGAGAACCCAGAAGTCCTCAGAAGGCTTGAAGACCTCTTCAAA AAGTACCTCGGTGGTTGAG atggccttcgaccccggtgaagtcagtaaagcgagcaggtttcacgcgttgatgaggctc gtcaggatagagcacacgctcttcagcctgccctacgcttacgtcggggcgttcctcagcggtttccacgttacctgggc cgagataatcctgatgagtcttgccctcctcgggcttagaacagctgcactggcctacaacaacatagccgacctcgaca tagacagccagaacccgaggacgtggaacaggccgctgattaaggggtcggtgaaggtgagcgacgcctggtggctcgtc gtcgttggctcagtggtttacttcgtttcggcggttctcctcaaccgctggactgctttactaagcccgattccctggtt aatagcgatgagctactcgggggcgaagaggaagcacagcttcccccatctccacctcggattaacgctcgccctggcgg tcgctggaggaacgatagcagctggaggaaacgctcctttcatagaagtcctcgcgcgggttccctgggcgttcttcttc ggcgtcctcttctgggtggcgggctttgacacgatatacgcgataatggactacgagttcgacgctgagcacggaatcgg gagcattcccgctaggtttggcatagagaatgccctcaaaattgccctcgccttccaccttctcgctatagccctctttg gccttgctgggttcctctacgacctcggatgggtttacttggctggctggctcgttggaagcgctctaatcctctacgag aacctaatcgtctggaagagccttgacaacgttccaaaggccttcaacctcaacattccaatcggcctaatcctcacgct ctcggccatagcggacaagcttttgggaggggtt TGAATGAGGAAGGTCCTGGCGTTGCTCCTAATTGGGCTGGTTGTG GTGGTTTCGGGTTGCATAGGCTCGAACTCGACGAAACCAACGGGAACGGAGATTCCCACCGTTAAAGCCGCAACATTGCT TGGAGGAATCAGCACTCTCGACGTCATGGAGGCTAAAGGCTTCGACAGGGAGAACGGCTTCAAGGTCGAGGTTCTCAGGC TCGGCAAGACCCCTGACATAATAGCGGCCCTCGAAAAGGGCGAGACGGACTTCGCGGTCATTCCCGCCGAGATGGCCGCT AAGCTTGCCCAGAGTGGGGTCAAGATTAAAATCATCGGCGTTGACATGCTCCAGAACCAGGCGATAATCGGGAAGGAGAA GATGAAGCCAGCCGAGCTGAAGGGTAAGAAAATCGGTGCCGTCGTCGCCTCGGGAACCTTCAAGCTCTTCCAGGCCTACA TGAAGGTTCTCTATAACCTTACTCCAGATGATTACACAGTCGTGAACGTCCCGCC