tg1236

Coordinates:1164609-1165025

>tg1236 hypothetical protein TGAM_1236
MSELKLTPEEVAAVRELVEVAVALKKGGTLGLLKSFTENGDRLLETISEEKALLRLAAIGNSALEPVREIEAEKVNDISM
NVEELVNALLRALAETNPKEVPKVGMTGAIGYLRDEDVQKGLGFLLTLAKNLGRVLNEK

>tg1236 hypothetical protein TGAM_1236
atgagcgagctcaagcttacccccgaagaggttgccgccgttagggaacttgtcgaggttgccgtagctctgaagaaggg
cggaaccctcggactgctcaagtccttcaccgagaacggcgacaggttactcgaaacaatctccgaagagaaggcccttt
tgaggctcgccgcgataggaaattcagccctcgaaccggtcagggaaattgaggcagagaaggtaaacgacatcagcatg
aacgttgaggaacttgtcaacgcccttctcagggccctcgcagagacaaacccgaaggaggttccaaaggtcgggatgac
gggagcgattggctacctccgcgacgaggacgttcagaagggcctcggcttcctattgacccttgcgaagaacctcggta
gggttttgaacgagaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1164109 - 1165525 (Additional range around tg1236 is :500nt.)

>Thermococcus gammatolerans EJ3 CGGGCACGAGAGAATAACCGAGGGCAAACTTGTAACCAAAAACCTCGAGCTCGACTACGACCTACTCATCAAGGTCCCGC CCATAGCGATTCCCGACGTCATGGCCTTCATGGCCGATAGCCAAGACCCGCGCTGGGCCAAGGTTAAGGGTCCTGACTTC CGCTACCCCGGCTACGATGATGTTTACGTCGTCAGCGAGGCGAGCATGCCACCCTTAGGGCTCTTAACGGCTGGTGTCCC GCTCCACAACGCGGCGGTAGTTTCTGCAACGAGCATACTCCACCAGGTGCATGGAGGCTATCCGATAGCCGAATTTGTCC CGACGATGTGCCTCGGCGTGGGTTATCACACGGGCTTCACGGCCAACTGCGAGTATAGGTGGACGGGGAGCAAGTACGAG AGAACCTGCTACCTGCTCTTCAAGAGCCCCCTCATAAAGGAGATGAAGGCCTCCTTCTACAGGGGCTGGCTTGACAGTTT GAGGCTGTGAGGTGAGGAAG atgagcgagctcaagcttacccccgaagaggttgccgccgttagggaacttgtcgaggt tgccgtagctctgaagaagggcggaaccctcggactgctcaagtccttcaccgagaacggcgacaggttactcgaaacaa tctccgaagagaaggcccttttgaggctcgccgcgataggaaattcagccctcgaaccggtcagggaaattgaggcagag aaggtaaacgacatcagcatgaacgttgaggaacttgtcaacgcccttctcagggccctcgcagagacaaacccgaagga ggttccaaaggtcgggatgacgggagcgattggctacctccgcgacgaggacgttcagaagggcctcggcttcctattga cccttgcgaagaacctcggtagggttttgaacgagaag TGATTCTTTCCCTTCTTTTTGGAGGTGGAACCGTGAGGGTT CTCTTCACCTACATGGGAGCGCCGACGACACCCGACGAAGTTGAGGACTTCATATTCCGCTTTCTCTACGACGTGAGGAA GGACATAGGACTCGACGTGCCGGGGGCCAGGGCGATAATCAGGGGCATAGCCAAGGCCCGCGCCCGGGCAGTCAGGGGCC ACTACGCGGTTATGGGCGGAAGAAGCCCTCTTGTGGATTACATGCGAGAGATAGCCGAGCTGGTGAGTGAGAGAACAGGT TATGAGATAACCCTCGGCATGTGCTATTCCAGACCTCTCCTTGAAGAACTGAGCGACGGCTTCGACCTCGTCTTTCCGCT CTACCACGTCTACTCCAGCTCGACGACCGAGAGGTGCCTGATTAAAATCAGAGAGCTCTTCGGTGAGAGACCCTACATCA GAGAGTGGTGGGGCAACGAGAGGTTCATAGCGTGGGTCAGGCACAACATCGAGAAGGG