tg1266

Coordinates:1189635-1189859

>tg1266 Putative carboligase of the ATP-grasp superfamily, C terminal part
MKKLEPPGIIGPFALHFAYDGSFRAIGFASRIDGGSNALHWYGRLYWNEPISVGRRIAREIKLALAEDRLGEVVS

>tg1266 Putative carboligase of the ATP-grasp superfamily, C terminal part
atgaaaaagctcgaaccgcccggaatcatcggccccttcgctctccactttgcctacgacggtagctttagggcgatagg
cttcgcctcgcggatagacggaggttccaacgccctccactggtatggaaggctctactggaacgagcccataagcgtcg
gaaggaggatagcgcgcgagattaagctcgccctcgctgaagaccggctcggggaggtggtatcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1189135 - 1190359 (Additional range around tg1266 is :500nt.)

>Thermococcus gammatolerans EJ3 GCCTACCTCGGCCTTGAGAGGATAGAGAAGGCCAAGGCAAGGTTCTTCGGCAACAAACGCTTCCTCAAGTGGGAAACGAC CTTTGAACTGCAGGATAAAGCCCTCGACGAGGCGGGAATCCCGAGGGTTCGGGTCATCGAGCCCGATGAGGTTGAGCCAG AGAAGCTCTACTTTGTCAGAATTGAGGGGCCGAGGGGAGGGAGCGGGCACTTCATAGCGAAGGGGAGCGAGCTTGAAGAG AGGCTTGCAGGGCTGAGCGAGCCCCCCAGGATTGAGGAGTTCATACCGGGGGTCTACCTCTACGTCCACTTCTTCCACTC GCCGATTCTGGGAAGGCTCGAACTCCTCGGCGTCGACGAACGCGTCGTCATAGCCGATGGAAACGCCCGCTGGCCCGTTA AGCCCCTCCCCTACACCATAGCGGGGAACGTTGGTGTCGCTTTGAGGGAGTCGCTCCTGCCGAGGCTCTACGACTACGGC CTGGCGTTCGTGGGAAGCT atgaaaaagctcgaaccgcccggaatcatcggccccttcgctctccactttgcctacgac ggtagctttagggcgataggcttcgcctcgcggatagacggaggttccaacgccctccactggtatggaaggctctactg gaacgagcccataagcgtcggaaggaggatagcgcgcgagattaagctcgccctcgctgaagaccggctcggggaggtgg tatcg TGACATACACGGGCAGAACCCTCGGGGTCGGACTGATGAAGGGAAAGCCCTTCGCCTTCTACCTCCTCTGCTCC CGTTCCTTCCCGAGAAGGAGGGCAATCGTGAGGGAAAACGCAGTCTACATCGAGAATCTCACGGAGACGGACAACCCCTA CATCAGCTACCCGGTCGTGAGGCTCCTCAGCGAATACGCCGTCGTCACCAACGGCCTGCAGACGGACTTCATTGCCCAGG CCCTCGAGTGGGAAAGCCCGAAGAAGGCCCTAATCCACGTTCTTGATGCCCTCGACTACGAGAGAGACGCCTACAGCACG CCGAGGATAGCGGGCATCGTGGGGAGAAACGGCAAGGGGTGGCTCGGCTTCGCTGGAAAGGACGAGTTTTGGGTAAGGGA GCTGGAGCTGAGGGAAGGGAAGGCCTTCGCCACGGCAACGTACAACCTCGGCTTCACCGAGCTTGAGTTCCCGGCCTTTG AGAGCGCCGAAGAGCTTGCGAGAAAG