tg1270

Coordinates:1192601-1193350

>tg1270 Thiazole biosynthetic enzyme
MLREIEISRAIIEAYTAELLESLSLDVAIVGAGPSGMVAGYYLAKNGAKVAIFEKKLSIGGGIWGGAMGFNKIVVQEEAR
EILDEFGINYRPFGNGLYVADAIETATTIASRAVKAGVRFFNMIEVEDLVLKNNRVAGIVINWTPVMRTGLHVDPLTVEA
RFVVDSTGHGAQVSQHLVRRGLLQVPGEGPMWAEKGEELTVKHTREVFPGLYVTGMAANAIAGAPRMGPIFGGMFLSGRK
AALEILEKLG

>tg1270 Thiazole biosynthetic enzyme
atgctgagggagatagagataagcagggcgataatagaggcctacaccgccgagcttctcgaaagcctgagccttgacgt
ggccatagtaggcgcgggtccttcgggaatggtcgccggttactacctcgcgaagaacggtgcgaaggtggcaatcttcg
agaagaagctctcaatcgggggcggaatctggggcggcgcgatgggcttcaacaaaatcgtcgttcaggaggaagcgagg
gaaatcctcgacgagttcgggataaactacaggcccttcgggaacggcctctacgttgccgacgccatcgagacggctac
gacgatagcgagcagggctgtaaaggccggcgtaaggttcttcaacatgattgaggttgaggatttggtcctcaaaaaca
accgcgtcgcgggaatagtgatcaactggacgccggtgatgaggacaggtctgcacgtcgacccgctcacggtcgaggcg
cgctttgtggttgattccaccggccacggggcgcaggtgagccagcacctagtgaggcgcggcctcctccaggttccggg
cgagggcccgatgtgggcggagaagggtgaggagctgactgtgaagcatacgagggaggtcttccccggcctctacgtta
cgggaatggccgccaatgctatcgctggagcgccgaggatgggtccgatattcggcgggatgttcctgagtggaaggaag
gcggccctcgaaatccttgagaagctgggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1192101 - 1193850 (Additional range around tg1270 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTTCCCCTTAGCCAGCATCTCCTCGGCGGCCTGATAGATTGGAACGGTGCCAATGGGCACGTCAACGGCGTGCATGATG GCCTTCCTTATCGAATCGAGGTCGCCACCAGTTGAGAGGTCCATTATCGTGTCGGCGCCGTATTTCACGGCGACCTTGGC CTTCTCTATCTCCGCCTTAACGTTCACTATGTCGCGCGACGTTCCAATGTTGGCGTTGACCTTAACGCGGACGACGTTGC CAACTGCCACAGGCTTAACCCAGTCGTGGCGGACGTTCCTGAATATCACCGTGTACCCCTTTGCCACGCTCCTCCTGAGC TTTTCAGGGTCTATTCCCTCCCGCTCGGCGATGAACTTCATCTCCTCGGTTATCTCTCCCCTCTTCGCGGCCTCAAGCTG GGTCATTCCAATCACCCGGTTTTAAAACCCGTTTATAACAAAGTTTTTAAATTTCAAAACTTAGTTTTGAGCGGAACTTA AAAGGTTTTGGGTGGTCGGG atgctgagggagatagagataagcagggcgataatagaggcctacaccgccgagcttct cgaaagcctgagccttgacgtggccatagtaggcgcgggtccttcgggaatggtcgccggttactacctcgcgaagaacg gtgcgaaggtggcaatcttcgagaagaagctctcaatcgggggcggaatctggggcggcgcgatgggcttcaacaaaatc gtcgttcaggaggaagcgagggaaatcctcgacgagttcgggataaactacaggcccttcgggaacggcctctacgttgc cgacgccatcgagacggctacgacgatagcgagcagggctgtaaaggccggcgtaaggttcttcaacatgattgaggttg aggatttggtcctcaaaaacaaccgcgtcgcgggaatagtgatcaactggacgccggtgatgaggacaggtctgcacgtc gacccgctcacggtcgaggcgcgctttgtggttgattccaccggccacggggcgcaggtgagccagcacctagtgaggcg cggcctcctccaggttccgggcgagggcccgatgtgggcggagaagggtgaggagctgactgtgaagcatacgagggagg tcttccccggcctctacgttacgggaatggccgccaatgctatcgctggagcgccgaggatgggtccgatattcggcggg atgttcctgagtggaaggaaggcggccctcgaaatccttgagaagctgggg TGATGTGATGGCCGTCCTGATTGTAGCG GGCCTCGACACGGGTGGCGGGGCGGGTTTAAAGGCCGACATCGAGACGGTCTCCGCTCTGGGCGAGCATCCGCTCCCGGT TCTGACGGCGGTGACCTACCAGAACCCCTTTGAGGTGAGGGGCTACCACACCCTTCCGTCCGAGGTCGTGAGGGAGGGGA TACGAGCCGTTAAGGACGGCTTTGAGGTCAAAGCCGTCAAAATCGGGATGCTCGGAAGCGGTGAGGTTGCCCGGGTCGTG AGGGAAGAGACCGCAGGTTTCCCCAGGGTTTTCGACCCCGTGATTGCCTCAAGCACCGAAAAAAAGCTCATTGACGACAC TGAGTCGCTCAAAACACTCGTCCCCGGTTCGATAGTCACTCCCAACGTCTATGAGGCTGAAGCGCTGGCGAGCATTGAAA TCCGCTCTGTGGAAGACATGAAGAAAGCGGCGACGGCCCTTGTGGAGGAGTTTGGCGCCGAGGCTGCGGTT