tg1274

Coordinates:1197462-1198022

>tg1274 Nitroreductase
MRVLDLARRRKTVRKFRPERPPMEDLLKALKAAKEAPSGMNAQPWKFVVVDDEWLKGRIRELCEAEERKFHSKTKGDLMA
WLQSEGFRPEKPFLSEAPYLVLVFGHTKAPYWLQSTWIAVGYLLLALEELGLGTVTYTPPNPKPVENLLNVPPQYKLQTI
LPIGYPADPAPKRGRRRLGEVVSFNGF

>tg1274 Nitroreductase
atgcgggtcctcgatcttgccagacgaaggaaaaccgtaaggaaatttcgaccggaaaggccgccgatggaagatctgct
gaaggctctaaaagcggcgaaggaagcgccgagcggcatgaacgcccagccctggaagtttgtcgtcgtcgatgatgagt
ggctgaagggcaggatccgagagctgtgtgaggctgaggagagaaagttccactcaaaaacgaagggtgacctgatggcc
tggcttcagagcgagggcttcagacctgagaaacctttcctgagcgaggccccatacctcgttcttgtttttggacatac
gaaggccccttactggcttcaatcaacgtggatagcggtcggctaccttctactcgcactcgaagagctcggccttggaa
cggtaacctacaccccgcccaacccaaagcccgttgagaaccttctcaacgtgccacctcaatacaagctccagacgatc
ctgcccatcggctatcccgccgatccggctcccaaacgcggaagaagaaggctgggggaggtagtgagcttcaacgggtt
c


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1196962 - 1198522 (Additional range around tg1274 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCTTCTCAAGTTTTAGCTCGAAGGTTGTGTTGAATTTAACTGATCTCACTTCACCGACCTCCACTATCATGGGGCAGAA AAACCCTGAAAGGGGCCTCCCAAGCAGTGGATCTATCCTGTCGTTGGACGAAACGTTATAAAGAGAGAGCGCAACGGAAA CGTTCCTCCAGAGCGGGGATCCCGAGAGCTTCAGCGCTTTAACGGCCAGAAGGTTATCGTTGGCGAGCCATATGGTCACG TTGTCGGGATACGTGGTAACCGAGGCCCGCAGCAGTCCGGCCTCAGGAACGTACTGGGACTCAAGAAAGCTCCGCATGGC CGTTACGCTGGGTTCTTGAACTGAAGGGTTCCGCGTCGAGACGAAGATTGTTATTATGACCAGCACGATTACAATCCCCA TGAGTGGAACTCTCCGCATGGGTGGGATATCCCCCGCGGGCGATAAAAAGTTGCCGAAACCCCTAAATCCCAGCAATTCC AAAAAAGTCAAGGTGACACG atgcgggtcctcgatcttgccagacgaaggaaaaccgtaaggaaatttcgaccggaaag gccgccgatggaagatctgctgaaggctctaaaagcggcgaaggaagcgccgagcggcatgaacgcccagccctggaagt ttgtcgtcgtcgatgatgagtggctgaagggcaggatccgagagctgtgtgaggctgaggagagaaagttccactcaaaa acgaagggtgacctgatggcctggcttcagagcgagggcttcagacctgagaaacctttcctgagcgaggccccatacct cgttcttgtttttggacatacgaaggccccttactggcttcaatcaacgtggatagcggtcggctaccttctactcgcac tcgaagagctcggccttggaacggtaacctacaccccgcccaacccaaagcccgttgagaaccttctcaacgtgccacct caatacaagctccagacgatcctgcccatcggctatcccgccgatccggctcccaaacgcggaagaagaaggctggggga ggtagtgagcttcaacgggttc TGATGCCGCTGAGGATTGCCCTAACTCGCCTGACGAAGTCCTTGAATTCCCTCGCCA GTTCTTCCTTTTGTTCCTCGCTCAGACCATCGAGCGAGCTGAAGGCCTCCTTGAGAACCTTTCCAACCTCAACCCCACCC AGGCGGGAGAATTCCCTGAACTTCTCCACAGTCCTGAGAACCTCTTCGAGCTCCCTTGAGTTCTCCTCAATGTACTTCCT ACCCTTTTCCGTCGCCCGGTAGAGCCTCTTCTCCCTCTTGCCCTCCCCTATAACTTCAATCAACCCCGATCTGCGAAGGG AGGCCAGGATGGGATATATCGTTCCGGGACTGGGCTGGGGCAGGCCATACCTCTCCTCCAGTTCCCGCATTATCCCGTAC CCGTGAAGGGGTTTCTCCGAAAGCATCTTGAGTATGAGGATCTTGAGATGACCGCGGTAGCTGGGTTTCTCCAAAGTCAC CACCACATGTCGGTCGATATATTCAGGTTTAAAACCTTTCGG