tg1277

Coordinates:1198963-1199652

>tg1277 Endonuclease III (nth)
MSLDGFTFEESWDEKRRRAEKIVEILMRTHPREKLLIGDPYRTLIHCIISQRMRDEVTYRVWEELFKKYGDIETIANTPV
DEMREFLRKRGVGLWKTKGEWIVKASRIILEKYGGKVPDDIKELMKLPGIGRKCANIVLAYGFGRQAIPVDTHVNRISKR
LGLAPPRVPPEKVEEYLMELIPKEKWIYVNHAMVDHGRSICRPIRPKCESCPLKELCPYAKGLVRDEDIK

>tg1277 Endonuclease III (nth)
ttgagccttgacggcttcaccttcgaggagagctgggatgagaagaggagaagggccgagaaaatagttgaaatcctcat
gaggacccacccaagggaaaagctcctcatcggtgacccttacaggacgctgatccactgcataatctcacagcgcatgc
gcgatgaggttacctaccgcgtctgggaggagctgttcaagaagtacggggacatcgagacgatagcgaatactcccgtc
gatgagatgcgagagttcctcaggaagaggggcgtcggcctctggaagacgaagggcgagtggattgtgaaggcatcgag
gataatccttgaaaagtacggcgggaaggtgcccgatgacatcaaagagctcatgaaactgcccggcataggcaggaagt
gcgccaacatcgttctcgcttacggcttcggaaggcaggcgattcccgttgatacgcacgtgaacaggataagcaagcgc
ctcggcctcgctccgccgagggttcccccggagaaggtcgaggagtacttgatggaactgattccaaaagagaagtggat
ttacgtgaaccacgcgatggtcgaccatggaaggagcatatgcaggccgataaggccgaagtgcgaaagctgtccgctga
aggagctctgcccctatgcgaaggggctcgtcagggacgaggacataaag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1198463 - 1200152 (Additional range around tg1277 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTTTCTCCAAAGTCACCACCACATGTCGGTCGATATATTCAGGTTTAAAACCTTTCGGCGCGATGGTTGATGGGTGATC CCATGAAGGTCGTTCTAAAACCCCTCTTCGACGCCGAACTACCCGCCGGGTTCGAGGAGATAGTACGGGAGAAGCTCAGG GGACGGGAATTGAGAACAGGTGAGACCGTCGAGGTTGACCTCCTCGGAAAGCCCCTGCCCTTCAAGGTTCTTCTGGCCGA ACCGAGTCCCCTGAAGGTTGGCAAGGGACTAAAAATAGAGTTCTCGACGGGAGAAATTGAAGAGTTCACCCTCGAGTTCG AGCGCGGGGTCGATGACGCGGTTCCCTTCACCAAGGGACTCGTGGTGGTTCTCGGGAGCGAGGTTCGAATCTATAACTGG AGCGGGCAAAAGATTTATAGCAGAAGGTTCGAGAACCTGAAAAAGGTTAGAGTAGCCGAGGGAAAGGTGGTGGTAGTGCA TGGCGAGGAAGTCACGGTCG ttgagccttgacggcttcaccttcgaggagagctgggatgagaagaggagaagggccga gaaaatagttgaaatcctcatgaggacccacccaagggaaaagctcctcatcggtgacccttacaggacgctgatccact gcataatctcacagcgcatgcgcgatgaggttacctaccgcgtctgggaggagctgttcaagaagtacggggacatcgag acgatagcgaatactcccgtcgatgagatgcgagagttcctcaggaagaggggcgtcggcctctggaagacgaagggcga gtggattgtgaaggcatcgaggataatccttgaaaagtacggcgggaaggtgcccgatgacatcaaagagctcatgaaac tgcccggcataggcaggaagtgcgccaacatcgttctcgcttacggcttcggaaggcaggcgattcccgttgatacgcac gtgaacaggataagcaagcgcctcggcctcgctccgccgagggttcccccggagaaggtcgaggagtacttgatggaact gattccaaaagagaagtggatttacgtgaaccacgcgatggtcgaccatggaaggagcatatgcaggccgataaggccga agtgcgaaagctgtccgctgaaggagctctgcccctatgcgaaggggctcgtcagggacgaggacataaag TGATCCAA AAACAAAAGGGTCAAAACTTCAGATTCACTCCCCTTATGACAACCTTCTTCCCAATCTCTTCCGAGAGATCCGAGGCTTC ACGGTACAGGAAGGATTCGAGGGTTTCTTTCAGGTTTCTGCGATCGGTACTGGAGTTTGGCTTCCCTTCGATTGTCACGT TAATATGAACCCCAACTCCGGCCCCCAGAGCGTATCTGACTTCTTTAGCTTCAATTCTCAGTGTGGAGACCTCAACACCC AGCGATTTGGCGTACTTTGCAATCCTGTTCCCAAAGGGCCTTAGATACGGCTCAATGTTCCTTGGGGCGTTAACTACAAG CTTGAGCTTTTTCGCGGGCTTTTTCCTGGCAACGGGAGTTTCCCTGGGGCCCTGTTCTTCTGCTTTCTCCTGTGCTCTTT CCTGAAGAACACGGGATACCCCTGCAGTAGAACTGGGAACGAGGGGACATAGCTCATCGAGGGACATCTTCGGGGTGGCA TTGTAAACATC