tg1281

Coordinates:1203828-1204496

>tg1281 hypothetical protein TGAM_1281
MLVEAYRDLKYLLNRGYRKSVALNFVANHYRLRKEERHLLARCVFSDSWIGEVKQKLLSPERVGGRVLGVDGFNVLITLE
SLLTGKAVLCEDGLVRDLEYRGKYRPHQHTAENLRFIISALSELSPERAVFFYGRNNPGSGLVKALTTELLSEFNVSGEA
RLVKSPDHELKAFEAVATADVGIVSSVRWVFDLARFAGERAGAKPVPFKDLLLRDQYDDRQPF

>tg1281 hypothetical protein TGAM_1281
atgctggttgaggcctaccgcgatctcaaatacctcctcaacaggggctaccggaagagtgtcgccctaaacttcgtggc
gaaccattaccggctgaggaaggaggagcggcacctcttggctcgctgtgttttctcggattcctggattggggaagtta
aacaaaagctcctttctccagaacgagttggggggcgagttctcggggtggacggcttcaacgtcctcataacccttgag
tcgctcctcaccgggaaggctgtactctgcgaggacggcctcgtccgggatttggagtaccggggaaagtacaggcccca
ccagcacaccgctgagaatctgaggttcatcatctcggccctttccgagctttctcctgaaagagctgtctttttttacg
gcaggaacaatccgggaagcggcctcgttaaagcgctgactaccgagctcctttcggagttcaatgtttctggggaagca
cggctcgttaagagcccggatcacgagctgaaggcctttgaagctgtggcgacggcggatgtggggatcgtaagtagtgt
gaggtgggtctttgatctggcccgatttgcaggggaaagagcaggggcaaagcccgttccattcaaggacttgttgcttc
gcgaccaatacgatgaccgccagcccttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1203328 - 1204996 (Additional range around tg1281 is :500nt.)

>Thermococcus gammatolerans EJ3 ACGACATAGGGAACATGATCCACAGGATAAACCACTACGAGTTCAGCGCCTTCCTTGCGGAGCCGATAATAGACAAGCTC GTGAACGAGTTTGAAAAGCGCGATCCACTTCTCCTGAAGGCCCTAACGCTCAACGCAATATACACCCACGACGAGCACGT GCCGTGCACCACAATAGAGGGCTCGCTCGTCACTATTGCCGACGGCTGCGACATGGAATCTGGAAGGAGCAGGTTAGCTT ACAAGAAGGATCGCGTGGATATCCACTCGGTCTCCGCCCTGGCCATAGAGCGGGTTGAGATAAGGGAGGGCGACGAGAGG CAACCGGTACTCATTGAGATCTGGATGAAGCACCCGGCGGGGATCTTTCAGGTGGACGAGATACTGACGAAAAAGGTCAA GAGCTCCCTGCTCACCGGAAAGGTTAAGCTGAGGATCCACACCGGCAAGGACGGCGAGACCCTCGAAAAGGTTATCTGAG CCTTTTCCCATTTTTCTCC atgctggttgaggcctaccgcgatctcaaatacctcctcaacaggggctaccggaagagt gtcgccctaaacttcgtggcgaaccattaccggctgaggaaggaggagcggcacctcttggctcgctgtgttttctcgga ttcctggattggggaagttaaacaaaagctcctttctccagaacgagttggggggcgagttctcggggtggacggcttca acgtcctcataacccttgagtcgctcctcaccgggaaggctgtactctgcgaggacggcctcgtccgggatttggagtac cggggaaagtacaggccccaccagcacaccgctgagaatctgaggttcatcatctcggccctttccgagctttctcctga aagagctgtctttttttacggcaggaacaatccgggaagcggcctcgttaaagcgctgactaccgagctcctttcggagt tcaatgtttctggggaagcacggctcgttaagagcccggatcacgagctgaaggcctttgaagctgtggcgacggcggat gtggggatcgtaagtagtgtgaggtgggtctttgatctggcccgatttgcaggggaaagagcaggggcaaagcccgttcc attcaaggacttgttgcttcgcgaccaatacgatgaccgccagcccttt TAGATAGCCCTCGAAAAGCTACAGGTTTGT TTGAAGTTTTGGAAAGTCTTTAATACCGGTGTGGCCAATATTATACAACCCCCTAAGGCCCGCTTTTCTTTCTTCGCGGG CTTTGGAGGAAGGAAGTATGAAAGGAAAAGCACTCGTTATTCCGCTGATAGCGGGAATGCTCCTGCTGGCTGGATGCCTC GGGGGCTCTGGCACATCAACGTCTAGCTCCCGGACACATACCTACACCCCAACCTCGAGTTCTCCCCAAACCCAGACCAC AACCGCACCCGGCCCGGAGACGTGGAACATGAGCGTCGTATGGCACGTCAACACCTCCGACATGCCGGTTATGGACCTGG CCCCGGACGGGAGTTTGGCCGCCGTGATAGACTGGTGGGGACACAGGATTTACCTTGCAAGTCCCGACGGAAGCGCGGTT TCCTTTGACCTGATGGAACCGGGAGACATCGTGGAGCCAGTTGTTGCTGGGGTGGCCATTGTTGAGGGTA