tg1283

Coordinates:1205428-1206195

>tg1283 hypothetical protein TGAM_1283
MKRFLPLLFAFLMFLQPVSAFNALEKLDQNGTYLCICIRGDATLKYGTPPTNLFNDTSIQELFILKPYNKTHLIRIVYYR
SGSRSEKIERITEYYPTTMEDVPFKLSDWNLSKVLREYQWGVRNYLPNVTGKHWYKGYWNSSIKKWEIGMNATVFNMTLH
GSFFGECHDYITFECWRNGTNVTCKWGKPVFKTHPGPPINGTISGMDTETTSTTSTTGTNTSSTQTTTSAKGEKTMCGPA
LLVGLILGPLLALRRR

>tg1283 hypothetical protein TGAM_1283
atgaaaaggttccttcccctgctttttgcctttttgatgttccttcagccggttagtgcgtttaatgctcttgagaaact
tgatcagaacggaacttacctctgcatctgcattaggggagacgcaaccttgaagtacggaacccctccaacaaatctat
tcaatgacacttcaattcaagagctcttcatactcaaaccctacaacaaaacgcacttgataagaatcgtctactatcgc
tccggatcgaggtcagagaaaattgagagaatcaccgagtactacccaacaacaatggaagacgttcctttcaagctttc
agattggaatttgtcaaaagtcctcagggagtatcagtggggtgttaggaactacttgccgaacgttactggaaagcact
ggtacaagggctactggaatagctcgataaaaaagtgggaaattggaatgaatgcaacggtctttaacatgactctccat
ggatctttcttcggtgagtgtcatgactacatcacattcgagtgctggaggaacggaactaatgtaacctgtaaatgggg
aaaacctgtctttaagactcatcccgggccaccaataaacggtacgatatcgggaatggatacagaaaccacgagcacaa
catcaactacagggactaacacatcaagcacacaaaccactacctccgccaagggggagaaaacgatgtgtggccccgcc
cttctagttgggctgatcctcggccccctgctggcactccggcgaagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1204928 - 1206695 (Additional range around tg1283 is :500nt.)

>Thermococcus gammatolerans EJ3 CGCCGAAAAAGGCCTCCCCTTTGTCCTCCTGATGCTGGTCCCAACCCTCTCGACCGCGTTCACATTCCCACTGATTTTGG TTTATCTCCCGGCGTTTCTCCCGCCCTATCTGATCAAGATGGACCTTGATCGTCTTAATGAGGCTAGGGGTGATGTCGAT GTTTATTAGGTATTCTCCTTTTTTTGGTTCCCCTAATTTTATCATCGAAAGTTAGTAGGGAAGTTTTTAAACAGAAGTGC CTTAATTTAATCTTGGCGGTTTGGAGGTGATTAGAAGGTGAGAATAGTTCTCACGATACTCTCATATATAAGGCTATCTT CCACCTTCTCGCCAAGGGTCACACGGCTGAGAATTGGTTCTATTCCTACGATGCAGGACTTTACCTCGACCTTGACTTCG ACGGCAGCCCCGATCAGGATCTGCCCTCTGGCTACATCCCGAAAACCGGCCCGTACACCTGTGTTGGTTACTATATGATC GCCCGCTGGGGGTGAGGAG atgaaaaggttccttcccctgctttttgcctttttgatgttccttcagccggttagtgcg tttaatgctcttgagaaacttgatcagaacggaacttacctctgcatctgcattaggggagacgcaaccttgaagtacgg aacccctccaacaaatctattcaatgacacttcaattcaagagctcttcatactcaaaccctacaacaaaacgcacttga taagaatcgtctactatcgctccggatcgaggtcagagaaaattgagagaatcaccgagtactacccaacaacaatggaa gacgttcctttcaagctttcagattggaatttgtcaaaagtcctcagggagtatcagtggggtgttaggaactacttgcc gaacgttactggaaagcactggtacaagggctactggaatagctcgataaaaaagtgggaaattggaatgaatgcaacgg tctttaacatgactctccatggatctttcttcggtgagtgtcatgactacatcacattcgagtgctggaggaacggaact aatgtaacctgtaaatggggaaaacctgtctttaagactcatcccgggccaccaataaacggtacgatatcgggaatgga tacagaaaccacgagcacaacatcaactacagggactaacacatcaagcacacaaaccactacctccgccaagggggaga aaacgatgtgtggccccgcccttctagttgggctgatcctcggccccctgctggcactccggcgaagg TGATCCCCTTT CCCTTCCTGTTTTCCCTTGGGTCAAAAACATGTGCAACCTCTGGGTTCAGAGCTTGGGCTTTGGAAACGTCCGCATTCAA AACCCTTAAAACCCCAAAGCCTCCACCGCCGGAGGTGGTGAAAATGTACAGCGAGGAGGAGATACTCCGTGAGATCAGGG AGCTTTTTGAGGACGAGAGGCTTTACAGGGCATACGAGAGAACCTTCAAGGAGTACCACTACTACTTCGACACGACCAAC TACATAGTGCTCAACGTCTACCAGTTCAACGATCACGGGCCCGTTCACGTTCTCTTAACGACGAGGCGCGCCCTTGAGCT CCTCAGAATAATCACGAAGTTCGGGATCCAGACGACGGCCGAGAAGCTCGGCAAACCCTTCTGGTGGAGCAAGTTCATCG TGGCCTTTGGAGCCCTCTTCCACGACATAGGGAACATGATCCACAGGATAAACCACTACGAGTTCAGCGCCTTCCTTGCG GAGCCGATA