tg1284

Coordinates:1206529-1207149

>tg1284 hypothetical protein TGAM_1284
MSEPYRKILNVSNHLPIMPYDDVIPNEYAAGKIKQAILLMKIIFIMPIILLSLIFAWWDELFLRDRLAVVIFLSPTFYIG
LVGIPSIRDVKENPREIVDRMFSFFNVVPFLTILALYFSDEIKSLPEPLGGILLLLSPLILSYLYHRLVRRIAEKGLPFV
LLMLVPTLSTAFTFPLILVYLPAFLPPYLIKMDLDRLNEARGDVDVY

>tg1284 hypothetical protein TGAM_1284
ttgagtgaaccgtatcggaaaattttaaacgtctcaaaccatctcccaatcatgccgtacgatgatgtaatccccaatga
gtacgcggcgggaaagataaaacaggctatcctcctgatgaagataatcttcatcatgccgataattctcctgtcgctca
tctttgcgtggtgggatgagctctttctgagagatcggcttgcggttgtgatcttcctttccccaacgttttacatcggt
ctcgttggcattccctcgatcagggacgtaaaggaaaatccccgggaaatcgttgacaggatgttctcgttcttcaacgt
tgttcccttcctcacgatcctggccctttatttctcagatgaaataaaatccctcccggagccgctcggcggtatattgc
tcctcctgagcccgttgatcctcagctacctctaccaccggctcgtcagacggatcgccgaaaaaggcctcccctttgtc
ctcctgatgctggtcccaaccctctcgaccgcgttcacattcccactgattttggtttatctcccggcgtttctcccgcc
ctatctgatcaagatggaccttgatcgtcttaatgaggctaggggtgatgtcgatgtttat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1206029 - 1207649 (Additional range around tg1284 is :500nt.)

>Thermococcus gammatolerans EJ3 TAAGCAGGCAGATCGGAAGCAGGTGGCGCCTCATCGGCTACGGCTTCATAAGGGAGTGAGCCCTCTTCTCTTTCCTTTCC GGTGGTCGCAATGGTCCATAGGAGAGAATGGCTCGTCCTTCCTGACACGAACTTCCTCCTCGTTCCCGGCCAGTTCGGGG TTGATATCGTTGGTGAGCTCAACAGAATCCTCGATGTCAGGTTCAAAATCGTAATCCCCAACGTGGTTCTCCGTGAGCTC GACGTTATAGAGCGGAAGACGCGAGGAAGGGATTTGCTCGCTGTTAGAATGGCGAAGAAACTAGCGGAGCGCTTTGAGAC CGTTGAAATCGGGGAGTTTGGGAAGAGACCGATAGACGACCAGATCTACGACTTCGCGATCAAAAACGAGCGCGTTATCG TCTGCACCAACGACAAGGGGCTGAAGAAGCGCCTCCGCGAGAAAGGGATTCCTGTTGTTTACCTCCGCTCGAAAAAGATA CTGGAGCTCGAGGGAATGC ttgagtgaaccgtatcggaaaattttaaacgtctcaaaccatctcccaatcatgccgtac gatgatgtaatccccaatgagtacgcggcgggaaagataaaacaggctatcctcctgatgaagataatcttcatcatgcc gataattctcctgtcgctcatctttgcgtggtgggatgagctctttctgagagatcggcttgcggttgtgatcttccttt ccccaacgttttacatcggtctcgttggcattccctcgatcagggacgtaaaggaaaatccccgggaaatcgttgacagg atgttctcgttcttcaacgttgttcccttcctcacgatcctggccctttatttctcagatgaaataaaatccctcccgga gccgctcggcggtatattgctcctcctgagcccgttgatcctcagctacctctaccaccggctcgtcagacggatcgccg aaaaaggcctcccctttgtcctcctgatgctggtcccaaccctctcgaccgcgttcacattcccactgattttggtttat ctcccggcgtttctcccgccctatctgatcaagatggaccttgatcgtcttaatgaggctaggggtgatgtcgatgttta t TAGGTATTCTCCTTTTTTTGGTTCCCCTAATTTTATCATCGAAAGTTAGTAGGGAAGTTTTTAAACAGAAGTGCCTTA ATTTAATCTTGGCGGTTTGGAGGTGATTAGAAGGTGAGAATAGTTCTCACGATACTCTCATATATAAGGCTATCTTCCAC CTTCTCGCCAAGGGTCACACGGCTGAGAATTGGTTCTATTCCTACGATGCAGGACTTTACCTCGACCTTGACTTCGACGG CAGCCCCGATCAGGATCTGCCCTCTGGCTACATCCCGAAAACCGGCCCGTACACCTGTGTTGGTTACTATATGATCGCCC GCTGGGGGTGAGGAGATGAAAAGGTTCCTTCCCCTGCTTTTTGCCTTTTTGATGTTCCTTCAGCCGGTTAGTGCGTTTAA TGCTCTTGAGAAACTTGATCAGAACGGAACTTACCTCTGCATCTGCATTAGGGGAGACGCAACCTTGAAGTACGGAACCC CTCCAACAAATCTATTCAATGA