tg1289

Coordinates:1211451-1212248

>tg1289 CRISPR-associated protein, Cas6 family
MRRMRFAIRLMPENEPYRVPFNHLRHLQGLIYRRIQRMNPNLSLRLHNPKVPKFFTFSLFMTERREFLNGKPHFLGSGRG
YFYFSTAVPEIAEAFIGGLLQNPELTLWGERFTVEEVRAIAEPEKLSGRKFVTLSPIAVTTKRIQFGRPRSYDLGPDEPE
FYEHLRENLVEKYTALTGRPPETGELKVRVLLAKPKRFEVKPGIYQRAWHLVFRAYGDEGLLRIGYLAGFGEKNSIGFGM
VKVDGRKERVKRRWKGGGRNREGKAA

>tg1289 CRISPR-associated protein, Cas6 family
gtgcggcggatgaggtttgcaataagactcatgccggagaatgagccgtaccgcgtcccgttcaaccacctccgccacct
tcaggggcttatctacaggaggattcaaaggatgaaccccaacctgagcttaaggctgcacaaccccaaagttccgaagt
tcttcacattctcgcttttcatgaccgaacgcagggagttcctcaacggaaagccccacttcctcggctccgggaggggc
tacttctacttctcaactgccgttccggagatagcggaagcgttcataggcggactcctccagaaccctgagcttaccct
ctggggtgagaggtttaccgtggaggaagttagggccattgcagagccggaaaagctgagcggaagaaagtttgtaactc
tctcgccgatagcggtgacgacgaagaggatccagttcggaaggccgaggagctacgatcttggaccggacgagccggag
ttctacgagcacctgagggagaacctcgtcgagaagtacaccgccctgaccgggaggcctccggaaaccggggagctgaa
ggtgagagttctcctagccaagccgaagcgcttcgaggtgaagcccggaatataccagagggcgtggcatctcgttttca
gggcctacggcgatgagggtctgctgaggatcggctatctggcgggttttggtgagaagaactcgatagggtttgggatg
gtgaaggttgatgggaggaaagagagagtgaaaaggcgctggaagggaggtggcagaaatcgggaaggtaaagccgct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1210951 - 1212748 (Additional range around tg1289 is :500nt.)

>Thermococcus gammatolerans EJ3 CCTACCCGATTCTCGCCGGAGCGCGCGGTGAGAAGCCGGTGGACATTGAGGCCCTTGCAGACATCATCGTCAAGGTCGGC GAGCTCGCCCTTGAGCTTCCAGAGATTAAGGAGCTCGACATCAACCCGATTTTTGCCTATGAGGACTCAGCTGTTGCCGT CGACGCGAGGATGCTCCTCTGAGGGCTTTTGCCCTCTTTCCATAATTATTCTAAATTTCCTCGCTATTTAGAAGTCAAAC CTTCTTCCATTCACCTGGATTATAACAGCCGTTATTATAATGGCGGTTATACTAATGGCCATTATACTTCTCCCCAGAGA GCCCGAAGGGATTAAAGTCACGGACTGGTGAGACTTTTTGAAGATCTCCAAACAGGAATTACTCACTTTTCTTTTTGTCT GTTAGAACATCATGAGCTGTTTTCGCGCTACTCTACAGCATGGGAAATCCTTATAAAGTTCAAAAGCGTACTCTTTTTGT TATAAGGTGACACAAATGGG gtgcggcggatgaggtttgcaataagactcatgccggagaatgagccgtaccgcgtccc gttcaaccacctccgccaccttcaggggcttatctacaggaggattcaaaggatgaaccccaacctgagcttaaggctgc acaaccccaaagttccgaagttcttcacattctcgcttttcatgaccgaacgcagggagttcctcaacggaaagccccac ttcctcggctccgggaggggctacttctacttctcaactgccgttccggagatagcggaagcgttcataggcggactcct ccagaaccctgagcttaccctctggggtgagaggtttaccgtggaggaagttagggccattgcagagccggaaaagctga gcggaagaaagtttgtaactctctcgccgatagcggtgacgacgaagaggatccagttcggaaggccgaggagctacgat cttggaccggacgagccggagttctacgagcacctgagggagaacctcgtcgagaagtacaccgccctgaccgggaggcc tccggaaaccggggagctgaaggtgagagttctcctagccaagccgaagcgcttcgaggtgaagcccggaatataccaga gggcgtggcatctcgttttcagggcctacggcgatgagggtctgctgaggatcggctatctggcgggttttggtgagaag aactcgatagggtttgggatggtgaaggttgatgggaggaaagagagagtgaaaaggcgctggaagggaggtggcagaaa tcgggaaggtaaagccgct TGATGTGTATTCAAAAAGGCAAGTGAGAAAGCCTCTAGTGTTCGATAACCCCATTCACAT GATCATAGCACTTCATTCGGAGTGAGATGCTATAAGCCGTCGGAGTGATAATTCTTAAACCAGAGGAACCACGAGCTTTT TCCTTCCCCGCTTCTCCTTTTTGATGTAACCTTTTCTTTCCAAGCGAGACACATACTCACTTATAAAAGGCGTGGAATAC GTTGAATCGTTTATGAGTTCCAATTGATTTCTCAGTTCTGTAAGACTCGGCGGCCGTCTCCTCCTTTTTATATAATCCTG TGCGAGTTTCAATATCTGTAACTCTAAGGGAGTTAGCTGAACTTTGGGGTCCACCACGGGAAACTCTATAACACCGCCCT TCTCCGTGACGTAAAAGACGGACTTTATTGCTTCTGGATTCTCATTTCTGACAAGAACGGCCGCATAGAGGAGTTCATAC CCCACTATTCGCCTCCCACCTGTGATGTTTATTACTGTC