tg1291

Coordinates:1213099-1213500

>tg1291 hypothetical protein TGAM_1291
MLKYCFRTMFSMVFPMEEWIRNIGRYLSYLVDENFGEYAYDIVDGIAKARTGEELLENVYKALRLAPKLEKKAEKKCNFR
KPSPADIEALEREVESVSNDPHKLRRLALKLALWAFAYWNHCPKKEQKNEGGEN

>tg1291 hypothetical protein TGAM_1291
atgcttaaatattgcttccgcactatgtttagtatggtgttccctatggaagagtggattcggaacattggaaggtacct
cagctatctggtagatgagaactttggagaatacgcctatgacatcgttgatggcatcgccaaagccagaaccggggagg
aactcctcgaaaacgtttacaaggccctcaggctcgcgccgaagctggaaaagaaggctgaaaaaaagtgtaacttcagg
aaaccttctccagcggacatcgaggctcttgagagggaagttgaatccgtttccaatgaccctcacaagctccgcaggct
cgcgctcaagctggccctctgggcattcgcctactggaatcactgccctaaaaaggagcagaaaaacgaagggggtgaaa
ac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1212599 - 1214000 (Additional range around tg1291 is :500nt.)

>Thermococcus gammatolerans EJ3 CCACCACGGGAAACTCTATAACACCGCCCTTCTCCGTGACGTAAAAGACGGACTTTATTGCTTCTGGATTCTCATTTCTG ACAAGAACGGCCGCATAGAGGAGTTCATACCCCACTATTCGCCTCCCACCTGTGATGTTTATTACTGTCTCGGGAATTAT GAGCTTCTTAAACTCTTCTATCCTCTCTTGGAACAGGTATGGTTCTTTGACTTCTATCACTGCCACAGGGATTCCTAGGC CTTTAAATCCTTCCTCTGCGTCTTTAACTTTGGAGAGGACTATCTCTCGATATTCCTTGGTGGCATCTTCCCTTATTGAA TAAAGCACGACAGCACTGCTGATTTGGGAGTTCCCTTCGCTGATTCTCTTGGGCAGTATCACCTCTCCATTTCTGAATAT GTGATTGATGTGTTCCCCTACTGTAACCACGTATCTCATTCTCCCACCATACTTGATTAAATCTCAATACTTAATAAACT TAACTTAACTACCTAAAACA atgcttaaatattgcttccgcactatgtttagtatggtgttccctatggaagagtggat tcggaacattggaaggtacctcagctatctggtagatgagaactttggagaatacgcctatgacatcgttgatggcatcg ccaaagccagaaccggggaggaactcctcgaaaacgtttacaaggccctcaggctcgcgccgaagctggaaaagaaggct gaaaaaaagtgtaacttcaggaaaccttctccagcggacatcgaggctcttgagagggaagttgaatccgtttccaatga ccctcacaagctccgcaggctcgcgctcaagctggccctctgggcattcgcctactggaatcactgccctaaaaaggagc agaaaaacgaagggggtgaaaac TGATGTACGTTCGGATAAGCGGTAGGGTCAGGTTGAACGCTCATTCCTTAAACGCT CAGGGCGGAGGGGGAAGCAACTACATCGAGGTCACCAAGACGAAAGTGACTGTGAAGACCGACAACGGCTGGGCCGTCGT CGAGGTTCCGGCCATTACGGGGAACATGGTGAAGCACTGGCACTTCGTCGGCTTCGTGGACTACTTTAGAAAGACACCAT TCAAGGATAACCTCACCGAGAGGGCGCTGAGGTACAACGGGACGAGGTTTGGGCAGGGCGAGACTAAGGCAAAGAAGGCA GATGGCACGGAGGTTGAGCTCAAAGATGAGGGGAAAATAATAAAGCACCTCGCCGATGCAGACGTCCACGGCTTTCTTGC CCCAAAGACCGGGGTTAGGAGGGTCTCCCTCGTCAAGACCTCGTTCGTGGTTCCCGCGGAGGACTTCATAAGGGAGGTCG AAGGCGAGCGCCTGATAAATGCCGTAAAGCACAATCGTGTTGA