tg1295

Coordinates:1217297-1218010

>tg1295 CRISPR-associated HD domain protein
MTLLAFKGQPLEEHVKAMLQAWNEVKGKYIPSIIRAMKAYGVELSREKVDRLMRALIILHDSGKGARIYQDYLKDGEKLG
GFRHELVSAYYALKILSQLFEERTAFVGSLVVMLHHEPILMGQIANFDRDSLSAEVTLDKLRNFDGVVSELDEFLRKSFK
KYLGADVEVPNAETGEVVRTVVELSVKARHLPDAGKLRLIVGALLIPLVLCDYKGAEDREGETPKFAEVLEAEWMGVV

>tg1295 CRISPR-associated HD domain protein
atgactcttctcgcgttcaagggtcagccccttgaggaacacgtgaaggctatgttgcaagcatggaatgaagtaaaggg
caaatacataccttccataatcagggcgatgaaagcttacggcgtcgagctaagcagagaaaaagtggataggcttatga
gagcgcttataattcttcatgactccggaaagggggcgaggatttaccaggattatcttaaagacggggagaagcttgga
ggtttcaggcacgagctggtgagtgcgtactatgctctgaaaatcctttcacagctcttcgaagagagaacggcgttcgt
tggctcacttgttgttatgctccaccacgagccgatactcatggggcagattgccaactttgacagggactccctgtctg
cagaagtgaccctggacaagctgagaaactttgatggagtggtctcagaactggacgagttcctgaggaaaagtttcaag
aagtaccttggtgcggacgttgaagttcccaacgcggagacgggggaagtcgtcaggactgtggtggagcttagcgtgaa
ggcacgccaccttcccgacgctggaaagcttcgcttaatcgttggggctctgctcattccgctcgtcctatgtgactaca
aaggcgctgaggatagagaaggggagaccccaaagttcgctgaagttcttgaggcggagtggatgggggtggta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1216797 - 1218510 (Additional range around tg1295 is :500nt.)

>Thermococcus gammatolerans EJ3 ATATCTACTTCAGGGAGCTTAAACTTTTCTCTGCACCGCCAGAATACGAGTTACGCTCACGGCCCGAGCTGTATTCAATG CTTTATATTCTCGATGAGGACCTGGAGAAGGAATTGAAGCCCAATTCGAGGAACGAGGTGAATCTCAATCCAAACAGAAT AATTCGCATCAGTCACTCCACTTTGGGGGCTATGTGGGACTCAATAAAGAATTGCATCAAAAGAAAGGTCGTGAGAGAGT GGGATTCGAAAAAAGAAAAGTATCGCTGGGTTCTTGAGAGCGTCAACGAGAAGAGCCCCAGAGCACTGACAATCTACGCC GTCTCCAAGGATTGCTACAGCGAGGAGCTCGGCCTCTGGAGGCGGACAAGCGACGCCACTGTAAATGGGAGAAAAGAGGT CAACCAAACCCAGGTGACCAGAACTTCTAAAACTCACGAAAAGAAAAACTTCGAAAAGAAAGGTCAGGCCACACTTCTTG ACTTCGTGGGGGGTGAGTGA atgactcttctcgcgttcaagggtcagccccttgaggaacacgtgaaggctatgttgca agcatggaatgaagtaaagggcaaatacataccttccataatcagggcgatgaaagcttacggcgtcgagctaagcagag aaaaagtggataggcttatgagagcgcttataattcttcatgactccggaaagggggcgaggatttaccaggattatctt aaagacggggagaagcttggaggtttcaggcacgagctggtgagtgcgtactatgctctgaaaatcctttcacagctctt cgaagagagaacggcgttcgttggctcacttgttgttatgctccaccacgagccgatactcatggggcagattgccaact ttgacagggactccctgtctgcagaagtgaccctggacaagctgagaaactttgatggagtggtctcagaactggacgag ttcctgaggaaaagtttcaagaagtaccttggtgcggacgttgaagttcccaacgcggagacgggggaagtcgtcaggac tgtggtggagcttagcgtgaaggcacgccaccttcccgacgctggaaagcttcgcttaatcgttggggctctgctcattc cgctcgtcctatgtgactacaaaggcgctgaggatagagaaggggagaccccaaagttcgctgaagttcttgaggcggag tggatgggggtggta TGAGTGGAGACTTACCAAACCCCTAGCGTTGATGGGATATTCGACCTTTACGTGGCATACGGCT ATGTTGAAGCCCTTGTGCGGGGCGGGGCGAAAGAGGTAACCCTTATTCCAAGGGGAACTTTGGAAGGAGGTTATTACAGC GTTAGAGGCGACGGGGACTTTAGGAGTGGACTAATTGGTGCGCTTAAGGAGATGCTTTCGCTACACTACGCTTTCGGTAA CTACCGTTATTCCCGTGAGGGTGTCAAAGTTATAAGCGACGCCGACTTCAGCGCGGGGGCAAATGTGAATAATACGTATT GGGATAGCGTTCCATCGCGATTGAGGGATGTCCGTGAGAAGTTAAAGGAAGGGAAAAAGCTTGGGGGAAAGTATCCTCTC CCCATAACTCTTATGCCCTCTGCTGGCAAATTCATACCAAAACACATGGGGGTTCAAGGAGGGAATCCCCTCAAAATAGA TCCTCTAAACTATGCTCTTGCCTGGGTGGGATTCC