tg1298

Coordinates:1219824-1220510

>tg1298 Nuclease, putative
MNLPKEIESFNERIRNAINGNHRPERRIWVTSLSYCLRKTALDIYLNAYSPSRNWEARIGSALHGWLADVVGSAEFEVPV
EYQIRDGWKLVGKAEAVKGPYVLEFKFKGFEGNGEGIPRKNYDLEHAEPSREWVEQINAYMGMLGKEKGYIYIFDRNGLD
FRVFPVEFDETLFRRFLRRAERVIEAVEELESGKFPRWISTVGRKDWVCNRCPYRPICAEIDREELKVR

>tg1298 Nuclease, putative
atgaacctccctaaggaaatcgaatctttcaacgagagaattaggaacgccataaacggcaaccacaggcccgagaggag
gatatgggtaacctctctaagctactgcctcaggaagaccgccctcgatatctacctcaacgcgtacagcccctcacgca
actgggaggccaggataggctccgccctgcacggctggctggcggacgtagtggggagcgcggagttcgaagttccggtt
gaatatcagataagagacgggtggaagctcgttggaaaggccgaggccgttaagggcccctacgttcttgagttcaagtt
caaggggtttgagggcaacggggaagggattccgcgaaaaaattacgaccttgagcacgcggagccatcgcgggagtggg
tcgagcagattaacgcctacatgggaatgctcggaaaggagaagggatacatctacatcttcgatagaaacgggcttgac
ttccgggtgtttcctgtcgagtttgatgagactctcttcaggaggttcctgaggagggccgaaagggtcattgaggccgt
agaggagctggaaagcgggaagttcccgcgctggatatcgacggtcgggagaaaggactgggtgtgcaaccgttgtcctt
accggccaatttgcgccgagattgatagggaggagctaaaggtcaga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1219324 - 1221010 (Additional range around tg1298 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAACGGACTCGCCATCGGCATCGGCCAGCTTCATATACTCCGGAAACGCCTTCTTGATGTGGAAGTTAGACCTGTTGAA ACCCCTAAGCGCCTCTCCGGACGGAAGCTTAAAACTCTCTCACCGGTCAGCGTTTACCACAACAATCCTCCCAACGGTTT CAGACAGTGGGACCTCTCGCCGGTTGGCCAGCCAAACAGCCCCTTCGAGAATGAGCCAGCCGTATGGAAGGAACTGGTCT TTAGAAACCTTCGCGAGAAGTATTTCATGGTTTACGGGGAGTCTTTTGAGGGAGATTTCGAGATTGAGGTTTTCCCGGAA AGCGCGAGGAGCAAGATGTTCAGGATTAAACGCGATGACAGAACCGGAAGGCACACTCAGGTTCGCGCCTGGGAGTTCTA CTTCAGAATGCAGGGTGATGAGGAGTTGCTCCGCGTTGCCCGGGACACTGGACTCGGAATGAGGAATGCTCACGGTTTTG GGATGATTGGGATGGTCTGA atgaacctccctaaggaaatcgaatctttcaacgagagaattaggaacgccataaacgg caaccacaggcccgagaggaggatatgggtaacctctctaagctactgcctcaggaagaccgccctcgatatctacctca acgcgtacagcccctcacgcaactgggaggccaggataggctccgccctgcacggctggctggcggacgtagtggggagc gcggagttcgaagttccggttgaatatcagataagagacgggtggaagctcgttggaaaggccgaggccgttaagggccc ctacgttcttgagttcaagttcaaggggtttgagggcaacggggaagggattccgcgaaaaaattacgaccttgagcacg cggagccatcgcgggagtgggtcgagcagattaacgcctacatgggaatgctcggaaaggagaagggatacatctacatc ttcgatagaaacgggcttgacttccgggtgtttcctgtcgagtttgatgagactctcttcaggaggttcctgaggagggc cgaaagggtcattgaggccgtagaggagctggaaagcgggaagttcccgcgctggatatcgacggtcgggagaaaggact gggtgtgcaaccgttgtccttaccggccaatttgcgccgagattgatagggaggagctaaaggtcaga TGATGTCCTCC ATCGGGTTCTTTTCCGTTCCGAGGACGTCGCGGAGGGGCTGTGAGCGAAGGCGGTAGATTACAACGGAGTCCTCATTTTC GTCTATTATCTCCCTCAGTCCGGCCTTAATCCTCTCGTACTCGGCCCTCGTGACTTCTCCCTCGAAGACGCTGTTCTGGA CCCAGTGGAGGTGCCGGCGGAGGAACTTCTTGACGTGGTTGACGCGCCTGACGTTGACGTCGTAGACAACGATGATGTAC ATAATACCACCATAGGGGTCAGGAAGTTCTGGATTTAACCTTTTCTGACATATCACGCTAGAAGTTCTTCAATTTTCAAA AAAGGCTGTTTGAGAGGAGGAAAATTGAAAATCTTCCCTCGAATACGGCTGGAAATCAATTTTTGTTGTTTTAAAATTGT TACTTATTGTTACATATTCCCGCTTGAACTGTAACGAATTTTCTTCGAGAATTGAAACGGAGCTCGTCAATCCCCCAGAT AATGCCAT