tg1310

Coordinates:1235323-1235613

>tg1310 hypothetical protein TGAM_1310
MIISKPCVTMKGVVIGAYSWERRIKLDLKKTAECLKERGYAVKKLLPGMMLIVEMEGYEVSVYPSGKIIVKLLEDAKKGE
EIARIVYDCAGVLEVVA

>tg1310 hypothetical protein TGAM_1310
atgatcatctcaaaaccctgcgtcacgatgaagggcgtcgtcattggggcctactcgtgggagaggaggataaagctcga
cctgaagaaaacggccgagtgtttgaaggagaggggctacgccgtcaagaagctcctgcccgggatgatgctcatcgttg
agatggagggctatgaggtgagcgtttacccgagcgggaagataattgtcaagctcttagaggacgccaaaaagggtgag
gaaatcgcgaggattgtttacgactgcgctggagttctggaggtggtagcg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1234823 - 1236113 (Additional range around tg1310 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTGTAGATGCCAAAGGCTATCGCAAAGTAGCCGGCCCACCTGAGGGGAATCCTGCCGGCTATGAACGTCAGGCCCAGCC CAAGGGTGTAGTACGAGATGTAGACGGCGATGACAAAGGATAGGCCGACGAGGTAGAGCCTCCTCTTATCCACGCCCTTC ACCGAGAGCGCGATGAGGAAGAGGGTGTACACCGCGAAGGTGCACGGATTGACGGAATCGGTCAGAGCCAGAGAAAGGAA CTGCGGTATAAAGTATGCCATGCCTATCAGGGAAAGAACGACAGCACTTATCCCGAAGGACAGCACGATTATCAGGAGCA GGTACTTGAACTCCCCCCTGCGCAGGATTTCCGCCGGCATGATACCAGCTAAGGAAGGGCCGATATTAGGTTTTCCTAAA CCGATGGTTCTCAACCTCAGGAGTTTGAACGCTAGCATCTTCAACCTAAGGTTTAGGAAACCCATAAAATCCGGCCGGCT GAGACTCAAGCGGTGGGAGC atgatcatctcaaaaccctgcgtcacgatgaagggcgtcgtcattggggcctactcgtg ggagaggaggataaagctcgacctgaagaaaacggccgagtgtttgaaggagaggggctacgccgtcaagaagctcctgc ccgggatgatgctcatcgttgagatggagggctatgaggtgagcgtttacccgagcgggaagataattgtcaagctctta gaggacgccaaaaagggtgaggaaatcgcgaggattgtttacgactgcgctggagttctggaggtggtagcg TGAGGAT TCCCGAAGATGTAAGAAAGGACATCCCGCTGACGAGCGAGGTGATTTATTTCGACAACACGGCCACTTCGCTCACGCCCA AACCTGTTGTGGAGGCGATGAACGAGTACTACCTCAGATACCGCGCCAACGTCCACAGAGGTGTTCACAGACTCTCCCAG ATGGCGACGCACAGGTACGAGGAGAGCAGGAAGGTGGTTGCGGACTTCATCAACGCGAAGTTCGAGGAGGTGGTTTTCAC CAAGAACACGAGCGAGAGCCTTAACCTTGTGGCTCTCGGCCTTGAGGGCATCTTCAGGCCCGGAGATAAGATAGTAACGA CTCCCTACGAGCACCACTCGGATTTGCTCCCCTGGCAGAGATTAGCTAAAAAGCTCGATCTCAGGCTTGAGTTCATCGAA GGGGACGACGAGGGCAACCTCGATTTAAGCGATGCGGAAAAGAAGATTAAGGGAGCCAAGCTCGTCGCGGTCCAGCACGT CTCCAACGCGCT