tg1312

Coordinates:1236812-1237708

>tg1312 hypothetical protein TGAM_1312
MRYSRIAVKLFEREGEDVFYDPAYHGRTLKVFGMEAFPDKALGYLAGEYHKKGYSRIIFDTKGSFDGVGFDTVLKIRDTQ
PSGLDPVKMAEKGYFDFYTAATIVQTIYGLDRALTETLYSDILAGKVESVPEALKAGQKYSEVIAESYTAIDQLLYSGEV
PELGQNILVDFGDAHSITLVGNAFLILAAAVEKRKKVMVGLNDAAVLTYTTAGGAGLPLLTKPALKRATVIASEYAPDSL
LNISGPVLLLYHDPDVQSMIYEANGVPPGPMRRHVLKGQGAFIYRTPETINVELGELHI

>tg1312 hypothetical protein TGAM_1312
atgaggtacagtagaatagccgttaagctgtttgagagggaaggtgaagacgtcttttacgaccccgcctaccacggcag
gactctgaaagtattcggaatggaggcgttccccgacaaagcccttgggtacctggcgggggagtaccataagaagggat
actcaaggataatttttgacacgaagggaagttttgatggagtgggcttcgatactgtcctcaaaatccgggatacacag
ccaagcggcctcgacccagtaaagatggccgaaaagggttactttgacttctacaccgccgctacgatagtacagaccat
ttacgggcttgaccgggcactcaccgagaccctctactctgatatcctggccgggaaagttgaaagcgtcccggaagcgc
tgaaggccggtcaaaagtactccgaggtaatcgcggagagctacacggccatagatcagctcctctactcgggcgaagtg
ccggaactcggccaaaacatcctcgtggactttggggacgcccacagcataaccctcgtcggaaacgctttcctgatact
cgcggccgccgttgagaagagaaagaaagtcatggtgggcctcaacgacgcagcggttttaacgtacaccacagcaggag
gcgcgggacttcccctcctaacaaagcccgcccttaagagggcaaccgtcatagccagcgaatacgcccccgattcccta
ctgaacatatccggtccggttctgcttctctaccacgacccggatgttcagagtatgatctacgaggccaacggcgtccc
cccgggtccgatgaggaggcacgttctcaaaggtcagggagcgttcatctaccgcacacccgagacgataaacgtggagc
tgggggagttgcacatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1236312 - 1238208 (Additional range around tg1312 is :500nt.)

>Thermococcus gammatolerans EJ3 GACGCAACAATAGAGGCACTCGCCGAGGAGCTGGAAGATGGCGTCTACTTCTTGGGGGCAGGTTCAACCATAAAGAAGCT CAAGGACCGGCTGGGTATAGACGGAACGCTCCTCGGCGTTGACGTAGTCGAGATAAAGGACGGCAAGGCCCGGCTCCTCG TGAAGGATGCGGCCGAGAAGGATCTCCTCAAGTTTGCTGAGAGAAACCCGAAGATCATCGTCACCGTCATCGGGGGCCTT AACTTCCTATTCGGCAGGGGGAACCAGCAGTTCTCCGCGGAGGTTCTGAGGCACGTTCCAAAGGAGAACATAATAGTCAT TGCAACTCCCTCCAAGGTCAAGGACGGCTTTGTGAGGGTCTACACCGGCGACAGGGAAGTTGATGAGAAGTTCAGGGGCT ACATCAGGGTCAGGGTGGGTCCCTGGAGAGAGAGAATGGTCAAGGTAATCTAGCGGAAGCCGTTTATAGTTTGTTCACCA GGATGGATCGGTGGACTCC atgaggtacagtagaatagccgttaagctgtttgagagggaaggtgaagacgtcttttac gaccccgcctaccacggcaggactctgaaagtattcggaatggaggcgttccccgacaaagcccttgggtacctggcggg ggagtaccataagaagggatactcaaggataatttttgacacgaagggaagttttgatggagtgggcttcgatactgtcc tcaaaatccgggatacacagccaagcggcctcgacccagtaaagatggccgaaaagggttactttgacttctacaccgcc gctacgatagtacagaccatttacgggcttgaccgggcactcaccgagaccctctactctgatatcctggccgggaaagt tgaaagcgtcccggaagcgctgaaggccggtcaaaagtactccgaggtaatcgcggagagctacacggccatagatcagc tcctctactcgggcgaagtgccggaactcggccaaaacatcctcgtggactttggggacgcccacagcataaccctcgtc ggaaacgctttcctgatactcgcggccgccgttgagaagagaaagaaagtcatggtgggcctcaacgacgcagcggtttt aacgtacaccacagcaggaggcgcgggacttcccctcctaacaaagcccgcccttaagagggcaaccgtcatagccagcg aatacgcccccgattccctactgaacatatccggtccggttctgcttctctaccacgacccggatgttcagagtatgatc tacgaggccaacggcgtccccccgggtccgatgaggaggcacgttctcaaaggtcagggagcgttcatctaccgcacacc cgagacgataaacgtggagctgggggagttgcacatc TAACCCCTCAAACTTTTTACAAGCACCTCCATGACTCCAAGG AACGTCTCAACTTCCTCAAGGCTGTTGTAGACGTGGAACGAAGCCCTCACCGTCCCGTCTATCCCCAGCTTTTTCATAAC TGGTAAGGCACAGTGGTGGCCCGAGCGAACCATTATATTGTTCTCATCCAGTATCGCCGCGACGTCGTGCGGGTGGAGCG GCGGGACGTTGAAGCTAACGACTCCAGCGTGCTTATCGAGGTTCCTCGGCCCGTACCAGGGGATTTCGAGCTCATCAAGT CCCTCGGTGGTTCTCTTAACGAGCTTCCTCTCCTGCCTCTCGATTTTGTCTATCCCAATCTTCTCTATGTACCTTATTCC CGCGGCGAGGCCTATCGCTCCCCCTATGTTCGGCGTTCCCGCTTCAAAGCGCTCCGGCGGCTCGGTCAGCTTGTAACCGT CGAGGGAAACGTCCTCAATCGTTCCACCTCCGATTAGCGGCGGCTCGAAGACGTCGAA