tg1332

Coordinates:1256404-1256796

>tg1332 Thioesterase, putative
MEQRTHKLTSGRLVGKPVKIEPGRAEVELLTTDEMAVDEYGLVHGSFTFGLADYAAMLAVNEPTVVLGKAEVKFLKPVKA
GERLIARAEVVEDLGRKKIVRAEVLNDNGERVFEGTFHCYVLEKHVLEKGD

>tg1332 Thioesterase, putative
atggagcagaggacgcacaaacttacctccgggaggctcgtcgggaagcctgtgaagattgaacccggaagggcggaggt
tgagcttttaacgaccgatgagatggctgttgacgagtacggcctcgttcacggcagcttcacctttggcctggcagact
acgcggccatgctcgccgtcaacgagcccaccgtcgtgcttgggaaagctgaagtgaagttcctcaagcccgttaaggcc
ggtgagcggctgattgcgagggccgaggtcgttgaggaccttggcagaaaaaagatcgtgagggcagaggttctgaacga
taatggggagagggtctttgagggcacattccactgctacgttcttgagaagcacgtgctggaaaagggggat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1255904 - 1257296 (Additional range around tg1332 is :500nt.)

>Thermococcus gammatolerans EJ3 GGTCGTCGTCTTTCCAGGAACGCCGCTGTGGCATATGAGAAGCAAAGTCAAGACAGAGAAGCACAAGCGCTTAATCCAGC ACTACCGCCACAAGATAAGGCACGAGATTGATTTGCCGATGCTCAAAAGGGTCGTCCCGGTTGGGACGGTTCTGAGGGAC GTTCGTGCTGAGGTCTTTGATAACGGCCTAACTTATGGGAGGCAGATAGGGAGCTACCCCCTCATCGTCGGGATTCCCAA GGAGGTTCCCCTAAACCGCTTCTACGACGTTCTAATCGTTGATCACGGCTTCAGGAGCATAACCGGAATCCCAGTTCCGA TAAATGTGAACCGAGAGAGCCCCAAAGTTCTGCAGCTCATCCCGGGAATCGGAAAGAAGACCGCAACCAGAATCCTCGCG AAGAGGCCCTTCAGGAGCAGAGAAGAGTTCTTTGAGGTCGTGGACCCGGGAGTGCGGGAGGTTTTAAAGGATCTTGTGGA ACTCTAACCGGTGGTCGCA atggagcagaggacgcacaaacttacctccgggaggctcgtcgggaagcctgtgaagatt gaacccggaagggcggaggttgagcttttaacgaccgatgagatggctgttgacgagtacggcctcgttcacggcagctt cacctttggcctggcagactacgcggccatgctcgccgtcaacgagcccaccgtcgtgcttgggaaagctgaagtgaagt tcctcaagcccgttaaggccggtgagcggctgattgcgagggccgaggtcgttgaggaccttggcagaaaaaagatcgtg agggcagaggttctgaacgataatggggagagggtctttgagggcacattccactgctacgttcttgagaagcacgtgct ggaaaagggggat TAAACGAGGTCCCTCTCCTTCAAGACCTTTTCCATCCTGTCCATCGCTTCCTCAAGCTTCTCGTAG GCTGTTGCATAGCTTATCCTGATGTAGCCCTCACCGGCCTTTCCAAAGGCCGAGCCCGGAACGACGGCAACTTTCGCCTC CTTCAGCATGAGCTCGCTGAACTCGTGGTCTGTCAGACCGGTATCCCTGATCCTCGGGAATATGTAGAACGCTCCCTTTG GCTTGACAGTTGGGAGTCCCATCTCGTTAAGACGCTTCCAAACGAGCTTTCTCCTCCTGTCGTACTCCTTCCGCATCTCC TCAACGGCCTTCCAGCTCCGTTCATCCTCAAGGGCCTTGGCAGCGGCGTACTGGGCGAACGTAACGGGACATGTGGCGTT GTACATCTGGAAGCGTGTCATCTTCTCGATGATCCAGGCCGGGGCCGCGACGAAGCCGAGCCGCCAGCCCGTCATGGCGA AGGTCTTGGAGAAGCCGTTTATCGTTATCGTCCT